BLASTX nr result
ID: Ziziphus21_contig00032948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00032948 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus g... 59 1e-12 gb|KMT03782.1| hypothetical protein BVRB_8g189280 isoform B [Bet... 67 7e-09 >gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] Length = 143 Score = 58.9 bits (141), Expect(2) = 1e-12 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 253 GRVLHELVSQVRNEPCLRSRATSSCXXXXXXXXLDNRHSSMV 128 G VLHELVSQVRNEPCL+SRATS+C LDN+HSS+V Sbjct: 35 GGVLHELVSQVRNEPCLQSRATSACLLLAKLLELDNKHSSIV 76 Score = 40.8 bits (94), Expect(2) = 1e-12 Identities = 21/26 (80%), Positives = 23/26 (88%), Gaps = 1/26 (3%) Frame = -2 Query: 101 YIGAIAKPSRIKASSPY-SDSKQTAY 27 YIGAIAKPSRIKASSPY S+SK+ Y Sbjct: 87 YIGAIAKPSRIKASSPYSSNSKRPTY 112 >gb|KMT03782.1| hypothetical protein BVRB_8g189280 isoform B [Beta vulgaris subsp. vulgaris] Length = 1629 Score = 66.6 bits (161), Expect = 7e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 160 EASPEASKTRSLCFVDKARSVLDLRARVVLAPISKGA 270 E SPEASKTRSLCFVDKARSVLDL+ARVVLA ISKGA Sbjct: 1236 EVSPEASKTRSLCFVDKARSVLDLQARVVLASISKGA 1272