BLASTX nr result
ID: Ziziphus21_contig00032617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00032617 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009336252.1| PREDICTED: ethylene-responsive transcription... 64 4e-08 ref|XP_009352357.1| PREDICTED: ethylene-responsive transcription... 60 6e-07 ref|XP_008392454.1| PREDICTED: ethylene-responsive transcription... 60 8e-07 ref|XP_007208855.1| hypothetical protein PRUPE_ppa025804mg [Prun... 60 8e-07 ref|XP_008239077.1| PREDICTED: ethylene-responsive transcription... 59 2e-06 ref|XP_010104995.1| Ethylene-responsive transcription factor CRF... 56 9e-06 >ref|XP_009336252.1| PREDICTED: ethylene-responsive transcription factor CRF2-like [Pyrus x bretschneideri] Length = 341 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 201 SEFSDYSSFETLIPNDIFDFRSSIPDFFEETRSLRDGGVLGDDFTD 64 SEFSDY+SFET IP+D+F+F +SIPDFFEET D G+L ++ TD Sbjct: 253 SEFSDYTSFETFIPDDMFNFETSIPDFFEETSLGDDVGILKEEMTD 298 >ref|XP_009352357.1| PREDICTED: ethylene-responsive transcription factor CRF2 [Pyrus x bretschneideri] Length = 355 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 201 SEFSDYSSFETLIPNDIFDFRSSIPDFFEETRSLRDGGVLGDDFTD 64 SEFSDY+SFET IPNDIF+F +SIPDFFEE D + ++ TD Sbjct: 254 SEFSDYTSFETFIPNDIFNFETSIPDFFEENNLRDDICISKEEITD 299 >ref|XP_008392454.1| PREDICTED: ethylene-responsive transcription factor CRF2-like [Malus domestica] Length = 348 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 201 SEFSDYSSFETLIPNDIFDFRSSIPDFFEETRSLRD 94 SEFSDY+SFET IPNDIF+F +SIPDF EET SLRD Sbjct: 254 SEFSDYTSFETFIPNDIFNFETSIPDFLEET-SLRD 288 >ref|XP_007208855.1| hypothetical protein PRUPE_ppa025804mg [Prunus persica] gi|462404590|gb|EMJ10054.1| hypothetical protein PRUPE_ppa025804mg [Prunus persica] Length = 333 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -3 Query: 201 SEFSDYSSFETLIPNDIFDFRSSIPDFFEETRSLRDGGVLGDDFTDI 61 SEFS+Y+SFE+ IP+DIFDF++ PDF EET SLRD G+L +DF D+ Sbjct: 248 SEFSEYTSFESFIPDDIFDFQT--PDFLEET-SLRDVGILKEDFGDL 291 >ref|XP_008239077.1| PREDICTED: ethylene-responsive transcription factor CRF2-like [Prunus mume] Length = 333 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 201 SEFSDYSSFETLIPNDIFDFRSSIPDFFEETRSLRDGGVLGDDFTD 64 SEFS+Y+SFE+ IP+DIFDF+ IPDF EET SLR+ G+L +DF D Sbjct: 248 SEFSEYTSFESFIPDDIFDFQ--IPDFLEET-SLREVGILKEDFGD 290 >ref|XP_010104995.1| Ethylene-responsive transcription factor CRF2 [Morus notabilis] gi|587915202|gb|EXC02952.1| Ethylene-responsive transcription factor CRF2 [Morus notabilis] Length = 333 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 201 SEFS-DYSSFETLIPNDIFDFRSSIPDFFEETRSLRDGGVLGDDFTDIVAA 52 SEFS ++SSFET IP+DIFDF+SSIPDFF++T G L D DI AA Sbjct: 255 SEFSSEHSSFETFIPDDIFDFQSSIPDFFDKT------GALEGDLNDIFAA 299