BLASTX nr result
ID: Ziziphus21_contig00032564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00032564 (336 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006441794.1| hypothetical protein CICLE_v10021298mg [Citr... 58 2e-06 >ref|XP_006441794.1| hypothetical protein CICLE_v10021298mg [Citrus clementina] gi|557544056|gb|ESR55034.1| hypothetical protein CICLE_v10021298mg [Citrus clementina] Length = 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 260 MRDFILAFEDFAEGLCWYMVEAVEFLNEEGIAFFLVVASLIEDFI 126 MRDFIL FE AEGLCWY++ A EF+ +E IAF LV+ LIE+ + Sbjct: 1 MRDFILEFEGLAEGLCWYLLGAFEFVADEFIAFCLVLGILIEELL 45