BLASTX nr result
ID: Ziziphus21_contig00032503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00032503 (239 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604989.1| NBS-LRR type disease resistance protein [Med... 56 9e-06 >ref|XP_003604989.1| NBS-LRR type disease resistance protein [Medicago truncatula] gi|355506044|gb|AES87186.1| NBS-LRR type disease resistance protein [Medicago truncatula] Length = 1045 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +2 Query: 2 LEALPVDIWKLVNLRHLYTDFAFRQIHLPRGLSQLTNLQTLTEF 133 L LP D+WKLV+LRHL D+ +PRG+ ++TNLQTLT+F Sbjct: 632 LRELPKDLWKLVSLRHLELDYCHNLTSMPRGIGKMTNLQTLTQF 675