BLASTX nr result
ID: Ziziphus21_contig00031486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031486 (1029 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD66740.1| orf310 (mitochondrion) [Beta vulgaris subsp. vul... 74 3e-10 ref|NP_064062.1| orf270 gene product (mitochondrion) [Beta vulga... 72 1e-09 ref|YP_008999568.1| hypothetical protein AT66_p10 (mitochondrion... 61 1e-06 >dbj|BAD66740.1| orf310 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 310 Score = 73.6 bits (179), Expect = 3e-10 Identities = 43/114 (37%), Positives = 61/114 (53%) Frame = -2 Query: 344 EADLSVRINRLEGLLGYLIVERQEPGGYLREVKESLTSAAEEGESEYLRCLEFEKFELSV 165 EA + RI LEG L Y + + EPG Y V+ A YL + E+F+L + Sbjct: 149 EAQIYQRIQALEGGLYYNLPPQNEPGEYAGIVRAHFDQAITV--DHYLLIFDKERFDLQL 206 Query: 164 REDKQVAQDLLFDFLLKEPNLGELVEISPSRDKNIREEAYDFLEEKIKDFEPCE 3 E K + QD LF+ +L +PNL + EI +IR+EAY FL+EK++ F E Sbjct: 207 LEGKAILQDKLFELMLNQPNLPRIYEICLHNQGDIRKEAYSFLQEKVEPFSDPE 260 >ref|NP_064062.1| orf270 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435042|ref|YP_004222257.1| hypothetical protein BevumaM_p018 [Beta vulgaris subsp. maritima] gi|346683135|ref|YP_004842064.1| hypothetical protein BemaM_p016 [Beta macrocarpa] gi|9087310|dbj|BAA99454.1| orf270 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905695|emb|CBJ14087.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439775|emb|CBJ17496.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500053|emb|CBX24869.1| hypothetical protein [Beta macrocarpa] gi|384939215|emb|CBL52061.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 270 Score = 71.6 bits (174), Expect = 1e-09 Identities = 44/114 (38%), Positives = 60/114 (52%) Frame = -2 Query: 344 EADLSVRINRLEGLLGYLIVERQEPGGYLREVKESLTSAAEEGESEYLRCLEFEKFELSV 165 EA + RI LEG L + + EPG Y V+ A YL + E+F+L V Sbjct: 109 EAQIYQRIQALEGGLYSNLPPQNEPGEYAGIVRAHFDQAITV--DHYLLIFDKERFDLQV 166 Query: 164 REDKQVAQDLLFDFLLKEPNLGELVEISPSRDKNIREEAYDFLEEKIKDFEPCE 3 E K V QD LF+ +L +PNL + EI +IR+EAY FL+EK++ F E Sbjct: 167 LEGKAVLQDKLFELMLSQPNLPRIYEICLHNQGDIRKEAYSFLQEKVEPFSDPE 220 >ref|YP_008999568.1| hypothetical protein AT66_p10 (mitochondrion) (mitochondrion) [Helianthus annuus] gi|12992|emb|CAA44478.1| ORF 873 [Helianthus annuus] gi|758363|emb|CAA37614.1| unnamed protein product [Helianthus annuus] gi|571031396|gb|AHF21041.1| hypothetical protein (mitochondrion) [Helianthus annuus] Length = 291 Score = 61.2 bits (147), Expect = 1e-06 Identities = 41/114 (35%), Positives = 59/114 (51%) Frame = -2 Query: 344 EADLSVRINRLEGLLGYLIVERQEPGGYLREVKESLTSAAEEGESEYLRCLEFEKFELSV 165 EA++ RI LE Y + + PG Y V+E A + Y L+ E FEL+V Sbjct: 132 EAEIFTRIRNLETQDYYNLPPQNNPGEYEVLVREEFEQALDV--PHYRTVLDREYFELTV 189 Query: 164 REDKQVAQDLLFDFLLKEPNLGELVEISPSRDKNIREEAYDFLEEKIKDFEPCE 3 E K + QD LF +L E + ++E+SP +NIR EAY+FLE ++ E Sbjct: 190 LERKGLLQDRLFHLMLGEQKISRIMELSPY--QNIRMEAYNFLEASVEPVSALE 241