BLASTX nr result
ID: Ziziphus21_contig00031331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031331 (314 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010087187.1| Zinc finger CCCH domain-containing protein 7... 60 6e-07 >ref|XP_010087187.1| Zinc finger CCCH domain-containing protein 7 [Morus notabilis] gi|587837689|gb|EXB28444.1| Zinc finger CCCH domain-containing protein 7 [Morus notabilis] Length = 2046 Score = 60.1 bits (144), Expect = 6e-07 Identities = 38/90 (42%), Positives = 53/90 (58%) Frame = -2 Query: 307 SPMTMKVEESEIDVNSHLKCVNKIEKNGKSSSSALCPQSLEKGKIDEVPENADNSGLGLH 128 SP+ ++ EE ID + KC N +EKNG ++ L SLE+ KI + PEN + G H Sbjct: 639 SPVAIESEEHRID-ETGTKCENPVEKNGNKLNTCLGFSSLEEIKIAKNPENTEYFGQSSH 697 Query: 127 AISKINKSLTKLLGVTSPDDIGCMVDVKQS 38 AIS N++L K L ++ DI + DVKQS Sbjct: 698 AISNNNENLVKSLNESTFLDIVNVEDVKQS 727