BLASTX nr result
ID: Ziziphus21_contig00031236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031236 (416 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107955.1| hypothetical protein L484_027545 [Morus nota... 59 1e-06 ref|XP_008236520.1| PREDICTED: uncharacterized protein LOC103335... 58 2e-06 ref|XP_007201328.1| hypothetical protein PRUPE_ppa009996mg [Prun... 56 9e-06 >ref|XP_010107955.1| hypothetical protein L484_027545 [Morus notabilis] gi|587930226|gb|EXC17355.1| hypothetical protein L484_027545 [Morus notabilis] Length = 155 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -3 Query: 141 QVRGSHLKFGDFILRRSPRFLHIRAVQENGGPSRLVDIISLVTELSR 1 Q GS KFGDF ++ SP +RAVQENGGP RLVDII +V ELSR Sbjct: 20 QATGSSGKFGDFSIQSSPGRFRVRAVQENGGPRRLVDIIRVVPELSR 66 >ref|XP_008236520.1| PREDICTED: uncharacterized protein LOC103335287 [Prunus mume] Length = 155 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = -3 Query: 141 QVRGSHLKFGDFILRRSPRFLHIRAVQENGGPSRLVDIISLVTELSR 1 Q R SH K+G F LR SP FL +RAVQE GG RLVDII V ELSR Sbjct: 20 QNRASHRKYGVFTLRPSPGFLRVRAVQETGGSRRLVDIIRNVPELSR 66 >ref|XP_007201328.1| hypothetical protein PRUPE_ppa009996mg [Prunus persica] gi|462396728|gb|EMJ02527.1| hypothetical protein PRUPE_ppa009996mg [Prunus persica] Length = 268 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = -3 Query: 141 QVRGSHLKFGDFILRRSPRFLHIRAVQENGGPSRLVDIISLVTELSR 1 Q R SH K+G F LR SP FL +RAVQE GG RLVDII V ELSR Sbjct: 20 QNRVSHGKYGVFTLRPSPGFLRVRAVQETGGSRRLVDIIRNVPELSR 66