BLASTX nr result
ID: Ziziphus21_contig00031215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00031215 (471 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfam... 57 4e-06 >ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508699249|gb|EOX91145.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = -1 Query: 471 HKIPDFNTLKHLXXXXXXXXXXXXXXXXIRTIKKKFPPNVLNSWKKV 331 HKIPDFNTLKHL IRT+KKKFPPN LN+WKK+ Sbjct: 341 HKIPDFNTLKHLVEGLVKNKKIKEAKGLIRTVKKKFPPNFLNAWKKL 387