BLASTX nr result
ID: Ziziphus21_contig00030879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030879 (370 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008351589.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 ref|XP_008392223.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 ref|XP_008387275.1| PREDICTED: pentatricopeptide repeat-containi... 99 9e-19 ref|XP_008350279.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_009374149.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_009379638.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_009379637.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_002529622.1| pentatricopeptide repeat-containing protein,... 88 3e-15 ref|XP_004306224.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_006489927.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_006489926.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_011020347.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 gb|KDO53700.1| hypothetical protein CISIN_1g004425mg [Citrus sin... 83 7e-14 ref|XP_006421425.1| hypothetical protein CICLE_v10004455mg [Citr... 83 7e-14 ref|XP_002277828.2| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_012466936.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 gb|KJB14965.1| hypothetical protein B456_002G151700 [Gossypium r... 78 3e-12 ref|XP_012086136.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 ref|XP_007028801.1| Tetratricopeptide repeat superfamily protein... 75 3e-11 ref|XP_010257207.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-10 >ref|XP_008351589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Malus domestica] Length = 711 Score = 100 bits (248), Expect = 6e-19 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = -2 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDD 4 RE T L NDWP+LLQLSIGS NL+LG A+HAFL+KCG QN TFQGNNLVN+YSK K+LDD Sbjct: 15 REYTFLFNDWPQLLQLSIGSKNLILGQAIHAFLLKCGXQNVTFQGNNLVNLYSKFKRLDD 74 Query: 3 A 1 A Sbjct: 75 A 75 >ref|XP_008392223.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Malus domestica] Length = 711 Score = 100 bits (248), Expect = 6e-19 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = -2 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDD 4 RE T L NDWP+LLQLSIGS NL+LG A+HAFL+KCG QN TFQGNNLVN+YSK K+LDD Sbjct: 15 REYTFLFNDWPQLLQLSIGSKNLILGQAIHAFLLKCGXQNVTFQGNNLVNLYSKFKRLDD 74 Query: 3 A 1 A Sbjct: 75 A 75 >ref|XP_008387275.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Malus domestica] Length = 737 Score = 99.4 bits (246), Expect = 9e-19 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = -2 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDD 4 RE TLL NDWP+LLQLSIGS L+LG A+HAFL+KCG QN TFQGNNLVN+YSK K+LDD Sbjct: 38 REYTLLFNDWPQLLQLSIGSQILILGQAIHAFLLKCGCQNDTFQGNNLVNLYSKFKRLDD 97 Query: 3 A 1 A Sbjct: 98 A 98 >ref|XP_008350279.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Malus domestica] Length = 714 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = -2 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDD 4 RE TLL NDWP+L+QLSIGS L+LG A+HAFL+KCG QN TFQGNNLVN+YSK K+LDD Sbjct: 15 REYTLLFNDWPQLJQLSIGSQILILGQAIHAFLLKCGCQNDTFQGNNLVNLYSKFKRLDD 74 Query: 3 A 1 A Sbjct: 75 A 75 >ref|XP_009374149.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Pyrus x bretschneideri] Length = 570 Score = 95.5 bits (236), Expect = 1e-17 Identities = 44/60 (73%), Positives = 50/60 (83%) Frame = -2 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDD 4 RE L NDWP+LLQLS GS NL+LG A+HAFL+KCG QN TFQGNNLVN+YSK K+LDD Sbjct: 15 REYAFLFNDWPQLLQLSTGSKNLILGQAIHAFLLKCGCQNDTFQGNNLVNLYSKFKRLDD 74 >ref|XP_009379638.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like isoform X2 [Pyrus x bretschneideri] Length = 716 Score = 94.0 bits (232), Expect = 4e-17 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = -2 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDD 4 RE TLL NDW LLQLSIGS L+LG A+HAFL+KCG QN TFQGNNLVN+YSK K+LDD Sbjct: 15 REYTLLFNDWLLLLQLSIGSKILILGQAIHAFLLKCGCQNDTFQGNNLVNLYSKFKRLDD 74 Query: 3 A 1 A Sbjct: 75 A 75 >ref|XP_009379637.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like isoform X1 [Pyrus x bretschneideri] Length = 811 Score = 94.0 bits (232), Expect = 4e-17 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = -2 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDD 4 RE TLL NDW LLQLSIGS L+LG A+HAFL+KCG QN TFQGNNLVN+YSK K+LDD Sbjct: 110 REYTLLFNDWLLLLQLSIGSKILILGQAIHAFLLKCGCQNDTFQGNNLVNLYSKFKRLDD 169 Query: 3 A 1 A Sbjct: 170 A 170 >ref|XP_002529622.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530907|gb|EEF32767.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 752 Score = 87.8 bits (216), Expect = 3e-15 Identities = 47/119 (39%), Positives = 65/119 (54%), Gaps = 5/119 (4%) Frame = -2 Query: 348 MPAIFSPTFHPCLSVTQQRFQLLEAKPHEEVVFARTLK-----HKAVHXXXXXXXXXXXV 184 M F T PC+S Q F LE K + + K + + Sbjct: 1 MTTFFPATLLPCISKPQFSFPQLEIKTPNSIFTCSSSKPVHNNNNLQNPKPNVTRYSTIS 60 Query: 183 REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLD 7 EDTLL NDWP L+++SIGS + +LG AVH++LVK GSQ+ TF+GNN++N+Y K +LD Sbjct: 61 NEDTLLFNDWPELIKISIGSRDFLLGQAVHSYLVKAGSQDDTFKGNNVLNLYVKFNRLD 119 >ref|XP_004306224.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Fragaria vesca subsp. vesca] Length = 764 Score = 85.9 bits (211), Expect = 1e-14 Identities = 43/62 (69%), Positives = 50/62 (80%), Gaps = 2/62 (3%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGT--FQGNNLVNMYSKLKKLD 7 + LL NDWP+LLQLSI S NLMLG A+HAFLVKC Q+ T FQGNNLVN+YSKL +L+ Sbjct: 58 QHNLLFNDWPQLLQLSIRSKNLMLGQAIHAFLVKCRCQSDTDAFQGNNLVNLYSKLNRLE 117 Query: 6 DA 1 DA Sbjct: 118 DA 119 >ref|XP_006489927.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like isoform X2 [Citrus sinensis] Length = 723 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/60 (65%), Positives = 50/60 (83%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 E TLLLNDWP+L+++SIGS +L LG AVHAFL+K GSQN TF+ NNL+N+Y+K +LD A Sbjct: 53 ERTLLLNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVA 112 >ref|XP_006489926.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like isoform X1 [Citrus sinensis] Length = 757 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/60 (65%), Positives = 50/60 (83%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 E TLLLNDWP+L+++SIGS +L LG AVHAFL+K GSQN TF+ NNL+N+Y+K +LD A Sbjct: 53 ERTLLLNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVA 112 >ref|XP_011020347.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Populus euphratica] Length = 763 Score = 84.3 bits (207), Expect = 3e-14 Identities = 49/125 (39%), Positives = 68/125 (54%), Gaps = 11/125 (8%) Frame = -2 Query: 348 MPAIFSPTFHPCLSVTQQRFQLLEAKPHEEVVFA--RTLKHKAVHXXXXXXXXXXXV--- 184 M A+ PC S +QQ F L+ KP + + LKH + Sbjct: 1 MNALLPAISLPCFSKSQQPFPPLKPKPPSTAFPSSFKPLKHSNSNKTQTPELKTTQNCTN 60 Query: 183 ------REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSK 22 E+TLL NDWP+LL++SIGS + +LG A+HA+LVK SQN F+GNNL+N+Y+K Sbjct: 61 ISLASPSEETLLSNDWPQLLKISIGSKDFLLGKAIHAYLVKIASQNDPFEGNNLINLYAK 120 Query: 21 LKKLD 7 +LD Sbjct: 121 FNRLD 125 >gb|KDO53700.1| hypothetical protein CISIN_1g004425mg [Citrus sinensis] Length = 754 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/60 (63%), Positives = 49/60 (81%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 E TLL NDWP+L+++SIGS +L LG AVHAFL+K GSQN TF+ NNL+N+Y+K +LD A Sbjct: 53 ERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVA 112 >ref|XP_006421425.1| hypothetical protein CICLE_v10004455mg [Citrus clementina] gi|557523298|gb|ESR34665.1| hypothetical protein CICLE_v10004455mg [Citrus clementina] Length = 703 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/60 (63%), Positives = 49/60 (81%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 E TLL NDWP+L+++SIGS +L LG AVHAFL+K GSQN TF+ NNL+N+Y+K +LD A Sbjct: 53 ERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVA 112 >ref|XP_002277828.2| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like [Vitis vinifera] Length = 789 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/56 (67%), Positives = 44/56 (78%) Frame = -2 Query: 168 LLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 L NDWP+LLQ+SIGS +LMLG A+HAFL K G QN F+GNNLVN+Y K KL DA Sbjct: 93 LFNDWPQLLQISIGSGDLMLGQAIHAFLAKLGYQNDAFRGNNLVNLYGKFNKLGDA 148 >ref|XP_012466936.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Gossypium raimondii] gi|823134222|ref|XP_012466937.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Gossypium raimondii] gi|823134224|ref|XP_012466938.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Gossypium raimondii] gi|763747527|gb|KJB14966.1| hypothetical protein B456_002G151700 [Gossypium raimondii] Length = 754 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 ++ +L DWP LL+LSIGS N +LG A+HAFL+K S N FQGNNL+N Y+K +L DA Sbjct: 49 KEVVLAEDWPHLLKLSIGSGNFLLGQAIHAFLIKSNSSNDVFQGNNLINFYTKFNELHDA 108 >gb|KJB14965.1| hypothetical protein B456_002G151700 [Gossypium raimondii] Length = 657 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 ++ +L DWP LL+LSIGS N +LG A+HAFL+K S N FQGNNL+N Y+K +L DA Sbjct: 49 KEVVLAEDWPHLLKLSIGSGNFLLGQAIHAFLIKSNSSNDVFQGNNLINFYTKFNELHDA 108 >ref|XP_012086136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like [Jatropha curcas] gi|643713050|gb|KDP26036.1| hypothetical protein JCGZ_21069 [Jatropha curcas] Length = 766 Score = 77.0 bits (188), Expect = 5e-12 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 6/120 (5%) Frame = -2 Query: 348 MPAIFSPTFHPCLSVTQQRFQLLEAKPHEEVVFARTLKHKAVHXXXXXXXXXXXV----- 184 M + T+ P LS Q+ F L+ +P + +++ +V + Sbjct: 1 MTILIPATWFPSLSKPQRSFPPLKTRPIFTCSAFKQIRNSSVQYPNPQITQYSTISGAFP 60 Query: 183 -REDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLD 7 EDTLL ++WP+LL++SIGS + +LG A+HA+LVK G Q F+ NNLVN+Y K +LD Sbjct: 61 CEEDTLLFSNWPKLLKISIGSRDFLLGQAIHAYLVKSGFQGDPFERNNLVNLYVKFSRLD 120 >ref|XP_007028801.1| Tetratricopeptide repeat superfamily protein [Theobroma cacao] gi|508717406|gb|EOY09303.1| Tetratricopeptide repeat superfamily protein [Theobroma cacao] Length = 758 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/60 (58%), Positives = 43/60 (71%) Frame = -2 Query: 180 EDTLLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 ++ LL DWP LL+LSIGS N +LG A+HAFLVK FQGNNL+N Y+K K+LD A Sbjct: 51 KELLLSEDWPHLLKLSIGSGNFLLGQAIHAFLVKSNCLYDVFQGNNLINFYAKFKELDGA 110 >ref|XP_010257207.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Nelumbo nucifera] Length = 766 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -2 Query: 171 LLLNDWPRLLQLSIGSWNLMLGLAVHAFLVKCGSQNGTFQGNNLVNMYSKLKKLDDA 1 +L+N W RLLQ+SI S ++LGLA HA LVK G +N F GNNL+NMYSK +L+DA Sbjct: 66 VLVNHWLRLLQISIESRGILLGLAAHALLVKSGPENDAFPGNNLINMYSKFGRLEDA 122