BLASTX nr result
ID: Ziziphus21_contig00030819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030819 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09784.1| hypothetical protein B456_001G165700 [Gossypium r... 83 9e-14 >gb|KJB09784.1| hypothetical protein B456_001G165700 [Gossypium raimondii] Length = 134 Score = 82.8 bits (203), Expect = 9e-14 Identities = 42/48 (87%), Positives = 42/48 (87%), Gaps = 2/48 (4%) Frame = -2 Query: 268 RSEGVTCLVLRCTHSRYENEMTPQLDSRPRLLTTRTNSG--RRLIERA 131 R EGVTCLVLRCTHSRYENEMTPQLDSRPRLLTTRTNSG R L RA Sbjct: 64 RGEGVTCLVLRCTHSRYENEMTPQLDSRPRLLTTRTNSGAERHLPTRA 111