BLASTX nr result
ID: Ziziphus21_contig00030650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030650 (411 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74382.1| hypothetical protein VITISV_007945 [Vitis vinifera] 35 3e-08 >emb|CAN74382.1| hypothetical protein VITISV_007945 [Vitis vinifera] Length = 444 Score = 35.4 bits (80), Expect(3) = 3e-08 Identities = 17/49 (34%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = -3 Query: 157 LSDYNLVKNRARK*TAHV-RYGHVDYIAYALEVAKKVDIKEPRSYQERI 14 L +Y L ++RARK + R+G+ D +A +L + K++ EP++Y E + Sbjct: 150 LENYQLTRDRARKSIRPLQRFGYNDMVACSLSIGKELRCAEPKNYLETV 198 Score = 34.7 bits (78), Expect(3) = 3e-08 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = -1 Query: 309 STRKCLISRDVVFKESEFLGLVDEQNTSVDGDSSRI 202 +T+KC IS DVVF+E EF L D++ TS + ++ + Sbjct: 87 TTKKCFISMDVVFRECEF--LKDDRETSTNKENGEV 120 Score = 33.9 bits (76), Expect(3) = 3e-08 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -3 Query: 409 LAFMHVREGKLQSRSVKCIFLGY 341 +A+ H EGKL+ R+ KCIF+GY Sbjct: 52 IAYAHQNEGKLEPRARKCIFVGY 74