BLASTX nr result
ID: Ziziphus21_contig00030149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00030149 (229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008341601.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_004306124.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_010088121.1| Pentatricopeptide repeat-containing protein ... 65 2e-08 ref|XP_009360596.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_007217570.1| hypothetical protein PRUPE_ppa020933mg [Prun... 60 6e-07 ref|XP_008230807.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_010258433.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 >ref|XP_008341601.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Malus domestica] Length = 632 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 139 MRWPSHTVIASLSCHQLRSFLRACARRSSLDVGKKFHAVLITSGLA 2 MRWP+ TV+ SL QLRS +R C R+SS+DVGKK HA ++TSGLA Sbjct: 1 MRWPTDTVLTSLPTRQLRSLIRECTRQSSVDVGKKLHAAIVTSGLA 46 >ref|XP_004306124.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial [Fragaria vesca subsp. vesca] Length = 634 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -1 Query: 139 MRWPSHTVIASLSCHQLRSFLRACARRSSLDVGKKFHAVLITSGLA 2 MRW +HT + SLS LRS +R C RRSS+DVGKK HA +IT+GLA Sbjct: 1 MRWSAHTALTSLSTRHLRSLIRECTRRSSIDVGKKLHAAIITTGLA 46 >ref|XP_010088121.1| Pentatricopeptide repeat-containing protein [Morus notabilis] gi|587841326|gb|EXB31933.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 753 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 139 MRWPSHTVIASLSCHQLRSFLRACARRSSLDVGKKFHAVLITSGL 5 MRWP + V++S S H LRS +R+C R+SSL+VGKK HAVLITSGL Sbjct: 228 MRWPINLVLSSHSAHHLRSLVRSCTRQSSLNVGKKLHAVLITSGL 272 >ref|XP_009360596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial [Pyrus x bretschneideri] Length = 632 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -1 Query: 139 MRWPSHTVIASLSCHQLRSFLRACARRSSLDVGKKFHAVLITSGLA 2 MRWP+ T + SL LRS LR C R+SS+DVGKK HA ++TSGLA Sbjct: 1 MRWPTDTALTSLPTRHLRSLLRGCTRQSSVDVGKKLHAAIVTSGLA 46 >ref|XP_007217570.1| hypothetical protein PRUPE_ppa020933mg [Prunus persica] gi|462413720|gb|EMJ18769.1| hypothetical protein PRUPE_ppa020933mg [Prunus persica] Length = 633 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -1 Query: 139 MRWPSHTVIASLSCHQLRSFLRACARRSSLDVGKKFHAVLITSGLA 2 MRWP++ +ASL LRS +RAC R+ S+D+GKK HA +IT GLA Sbjct: 1 MRWPTNAALASLPNRHLRSLIRACTRQCSIDMGKKLHAAIITGGLA 46 >ref|XP_008230807.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial [Prunus mume] Length = 633 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -1 Query: 139 MRWPSHTVIASLSCHQLRSFLRACARRSSLDVGKKFHAVLITSGLA 2 MRWP++ +ASL LRS +RAC R+ S+D+GKK HA +IT G+A Sbjct: 1 MRWPTNAALASLPNRHLRSLIRACTRQCSIDMGKKLHAAIITCGVA 46 >ref|XP_010258433.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial [Nelumbo nucifera] Length = 632 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -1 Query: 139 MRWPSHTVIASLSCHQLRSFLRACARRSSLDVGKKFHAVLITSGLA 2 MRWP+H ASL H RS LRACA R+SL+ G+K HA LI +GLA Sbjct: 1 MRWPTHRFCASLP-HYYRSLLRACAHRTSLEEGEKLHATLIKNGLA 45