BLASTX nr result
ID: Ziziphus21_contig00029835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029835 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200333.1| hypothetical protein PRUPE_ppa010416mg [Prun... 70 6e-10 ref|XP_008244576.1| PREDICTED: protein STAY-GREEN LIKE, chloropl... 58 2e-06 >ref|XP_007200333.1| hypothetical protein PRUPE_ppa010416mg [Prunus persica] gi|462395733|gb|EMJ01532.1| hypothetical protein PRUPE_ppa010416mg [Prunus persica] Length = 250 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -3 Query: 153 MACHCAHYVFIPSPQRYNTDKTN-LVSSKRPMTFLLSSFGNNRESYNTLVS 4 MACHCA+YVF PSP R N KT L+SSKRP + LLS+ NNR+SYNTLVS Sbjct: 1 MACHCAYYVFPPSPLRKNLYKTTTLLSSKRPKSLLLSAISNNRDSYNTLVS 51 >ref|XP_008244576.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Prunus mume] Length = 249 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 153 MACHCAHYVFIPSPQRYNTDKTN-LVSSKRPMTFLLSSFGNNRESYNTLVS 4 MACHCA YV SP R N KT L+SSKRP + LLS+ NNR+SYNTLVS Sbjct: 1 MACHCA-YVLPLSPLRKNFYKTTTLLSSKRPKSLLLSAISNNRDSYNTLVS 50