BLASTX nr result
ID: Ziziphus21_contig00029348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00029348 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010104858.1| hypothetical protein L484_024059 [Morus nota... 72 2e-10 ref|XP_008227538.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citr... 63 7e-08 ref|XP_004300367.2| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_009342093.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_009350933.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_009334533.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_007039757.1| Tetratricopeptide repeat-like superfamily pr... 57 4e-06 ref|XP_009338545.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_008369435.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >ref|XP_010104858.1| hypothetical protein L484_024059 [Morus notabilis] gi|587914315|gb|EXC02094.1| hypothetical protein L484_024059 [Morus notabilis] Length = 474 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/62 (58%), Positives = 44/62 (70%) Frame = -3 Query: 187 NPKFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS*M 8 NP+F T F SSADK+F+HL KN GGN+EKTLA LD K VS+VL +C+P QS M Sbjct: 18 NPQFSTIRFAITSSADKIFDHLNKN-GGNIEKTLATIKPKLDPKFVSDVLFKCHPSQSQM 76 Query: 7 GL 2 G+ Sbjct: 77 GI 78 >ref|XP_008227538.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Prunus mume] gi|645242412|ref|XP_008227539.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Prunus mume] gi|645242415|ref|XP_008227540.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Prunus mume] Length = 476 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/60 (53%), Positives = 43/60 (71%) Frame = -3 Query: 181 KFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS*MGL 2 KF F++AS + V+N L++N GGN+EKTL+ + LD+K VS VL+RCYP QS MGL Sbjct: 21 KFSILRFSSASDGETVYNRLQEN-GGNIEKTLSSINVQLDSKCVSQVLKRCYPSQSQMGL 79 >ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X1 [Citrus sinensis] gi|568846596|ref|XP_006477136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X2 [Citrus sinensis] gi|568846598|ref|XP_006477137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X3 [Citrus sinensis] gi|641842441|gb|KDO61346.1| hypothetical protein CISIN_1g011905mg [Citrus sinensis] gi|641842442|gb|KDO61347.1| hypothetical protein CISIN_1g011905mg [Citrus sinensis] gi|641842443|gb|KDO61348.1| hypothetical protein CISIN_1g011905mg [Citrus sinensis] Length = 475 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/63 (50%), Positives = 41/63 (65%) Frame = -3 Query: 190 ENPKFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS* 11 +N K HFTTAS A++ + HL+KN N+EKTLA A LD+ V VL RC+P QS Sbjct: 17 KNSKIFALHFTTASPAERFYTHLQKNPN-NIEKTLATVKAKLDSTCVIEVLHRCFPSQSQ 75 Query: 10 MGL 2 MG+ Sbjct: 76 MGI 78 >ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895520|ref|XP_006440248.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895522|ref|XP_006440249.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542509|gb|ESR53487.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542510|gb|ESR53488.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542511|gb|ESR53489.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] Length = 475 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/63 (50%), Positives = 41/63 (65%) Frame = -3 Query: 190 ENPKFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS* 11 +N K HFTTAS A++ + HL+KN N+EKTLA A LD+ V VL RC+P QS Sbjct: 17 KNSKIFALHFTTASPAERFYTHLQKNPN-NIEKTLATVKAKLDSTCVIEVLHRCFPSQSQ 75 Query: 10 MGL 2 MG+ Sbjct: 76 MGI 78 >ref|XP_004300367.2| PREDICTED: pentatricopeptide repeat-containing protein At5g47360 [Fragaria vesca subsp. vesca] gi|764591506|ref|XP_011465263.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360 [Fragaria vesca subsp. vesca] Length = 474 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/63 (52%), Positives = 41/63 (65%) Frame = -3 Query: 190 ENPKFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS* 11 +N F+TA+SA+ V NHL +N GG +EKTL LDAK VS VL+RCYP QS Sbjct: 18 QNHNLSISRFSTATSAETVLNHLHRN-GGKIEKTLDSMRLNLDAKCVSQVLQRCYPTQSQ 76 Query: 10 MGL 2 +GL Sbjct: 77 LGL 79 >ref|XP_009342093.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] Length = 476 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -3 Query: 190 ENPKFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS* 11 +N +F+TA++A+ V+NHL+KN GGN+E+ LA LD+K VS VL+RCY +S Sbjct: 18 KNHTLSILNFSTAAAAETVYNHLQKN-GGNVEEMLASVQVKLDSKYVSQVLQRCYGSRSQ 76 Query: 10 MGL 2 MGL Sbjct: 77 MGL 79 >ref|XP_009350933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] gi|694451608|ref|XP_009350934.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] gi|694451613|ref|XP_009350935.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] gi|694451617|ref|XP_009350936.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] Length = 477 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/81 (45%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = -3 Query: 241 LMALCXXXXXXXXXXXLENPKFVTFHFTTAS-SADKVFNHLKKNNGGNMEKTLAPFSALL 65 +M+LC L+N K F+TA+ SA+ V+NHL+KN GGN+E+ LA L Sbjct: 1 MMSLCSISRFVSSSFGLKNHKLSILLFSTAAASAETVYNHLQKN-GGNVEEILASIQVKL 59 Query: 64 DAKSVSNVLERCYPGQS*MGL 2 D+K VS VL+RC QS MGL Sbjct: 60 DSKYVSQVLQRCNGSQSQMGL 80 >ref|XP_009334533.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] gi|694412438|ref|XP_009334536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] Length = 476 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/63 (47%), Positives = 43/63 (68%) Frame = -3 Query: 190 ENPKFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS* 11 +N +F+ A++A+ V+NHL+KN GGN+E+ LA LD+K VS VL+RCY +S Sbjct: 18 KNHTLSILNFSRAAAAETVYNHLQKN-GGNVEEMLASVQVKLDSKYVSQVLQRCYGSRSQ 76 Query: 10 MGL 2 MGL Sbjct: 77 MGL 79 >ref|XP_007039757.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676515|ref|XP_007039758.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676519|ref|XP_007039759.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676523|ref|XP_007039760.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777002|gb|EOY24258.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777003|gb|EOY24259.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777004|gb|EOY24260.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777005|gb|EOY24261.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 483 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/60 (55%), Positives = 40/60 (66%) Frame = -3 Query: 181 KFVTFHFTTASSADKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS*MGL 2 K TF F+TASSADK F HL+K N+EKTLA ++ LD+ V VLERC +S MGL Sbjct: 20 KIFTFLFSTASSADKFFTHLQKKQS-NIEKTLALVNSKLDSNCVCEVLERCCFDKSQMGL 78 >ref|XP_009338545.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] gi|694421382|ref|XP_009338546.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] gi|694421385|ref|XP_009338547.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] gi|694421387|ref|XP_009338548.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Pyrus x bretschneideri] Length = 477 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 1/81 (1%) Frame = -3 Query: 241 LMALCXXXXXXXXXXXLENPKFVTFHFTTAS-SADKVFNHLKKNNGGNMEKTLAPFSALL 65 +M+ C L+N K F+TA+ SA+ V+NHL+KN GGN+E+ LA L Sbjct: 1 MMSPCSISRFVSSSFGLKNHKLSILLFSTAAASAETVYNHLQKN-GGNVEEILASIQVKL 59 Query: 64 DAKSVSNVLERCYPGQS*MGL 2 D+K VS VL+RC QS MGL Sbjct: 60 DSKYVSQVLQRCNGSQSQMGL 80 >ref|XP_008369435.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Malus domestica] Length = 477 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -3 Query: 190 ENPKFVTFHFTTASSA-DKVFNHLKKNNGGNMEKTLAPFSALLDAKSVSNVLERCYPGQS 14 +N K +F+TAS+A + V+NHL+KN G N+E+ LA LD+K VS VL+RCY +S Sbjct: 18 KNHKLSILNFSTASAAAETVYNHLQKN-GXNVEEILASVQVKLDSKYVSQVLQRCYGSRS 76 Query: 13 *MGL 2 MGL Sbjct: 77 QMGL 80