BLASTX nr result
ID: Ziziphus21_contig00027799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027799 (230 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010105847.1| hypothetical protein L484_002454 [Morus nota... 58 2e-06 >ref|XP_010105847.1| hypothetical protein L484_002454 [Morus notabilis] gi|587919101|gb|EXC06581.1| hypothetical protein L484_002454 [Morus notabilis] Length = 1015 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/63 (50%), Positives = 41/63 (65%) Frame = +3 Query: 3 IHQDVFPHKPSL*PINSIKSAGSGLSVSDLISSLYSQVEPNTSENHTPKVNGNGIYSSIR 182 + DV HKP+ NS K+ GS LS++DLI SLYSQ + +TS N TPKV+ NG S+ R Sbjct: 531 VETDVSIHKPASYTRNSNKAPGSNLSINDLIVSLYSQAQQSTSLNGTPKVSENGTPSTTR 590 Query: 183 GVE 191 E Sbjct: 591 EFE 593