BLASTX nr result
ID: Ziziphus21_contig00027684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027684 (556 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010105190.1| hypothetical protein L484_011024 [Morus nota... 71 4e-10 emb|CBI35339.3| unnamed protein product [Vitis vinifera] 71 4e-10 ref|XP_002271050.1| PREDICTED: uncharacterized protein LOC100262... 71 4e-10 ref|XP_010274923.1| PREDICTED: uncharacterized protein LOC104610... 70 5e-10 ref|XP_012833090.1| PREDICTED: uncharacterized protein LOC105953... 70 5e-10 ref|XP_006448505.1| hypothetical protein CICLE_v10015943mg [Citr... 70 5e-10 ref|XP_011091532.1| PREDICTED: uncharacterized protein LOC105171... 70 9e-10 ref|XP_011091531.1| PREDICTED: uncharacterized protein LOC105171... 70 9e-10 emb|CDP16398.1| unnamed protein product [Coffea canephora] 70 9e-10 ref|XP_009790222.1| PREDICTED: uncharacterized protein LOC104237... 69 1e-09 ref|XP_009125731.1| PREDICTED: uncharacterized protein LOC103850... 69 1e-09 emb|CDY60226.1| BnaA03g55710D [Brassica napus] 69 1e-09 ref|XP_009131064.1| PREDICTED: uncharacterized protein LOC103855... 69 1e-09 ref|XP_010935608.1| PREDICTED: uncharacterized protein LOC105055... 69 2e-09 ref|XP_010935607.1| PREDICTED: uncharacterized protein LOC105055... 69 2e-09 gb|KGN51579.1| hypothetical protein Csa_5G580640 [Cucumis sativus] 68 2e-09 gb|KFK25208.1| hypothetical protein AALP_AA8G081200 [Arabis alpina] 68 2e-09 ref|XP_006468675.1| PREDICTED: uncharacterized protein LOC102611... 68 2e-09 ref|XP_006399332.1| hypothetical protein EUTSA_v10014240mg [Eutr... 68 2e-09 ref|XP_004147093.1| PREDICTED: uncharacterized protein LOC101211... 68 2e-09 >ref|XP_010105190.1| hypothetical protein L484_011024 [Morus notabilis] gi|587916371|gb|EXC04044.1| hypothetical protein L484_011024 [Morus notabilis] Length = 302 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDLIGSV Sbjct: 153 KVSFRDFNPVDSYIWFELYGSPSDRDVDLIGSV 185 >emb|CBI35339.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDLIGSV Sbjct: 179 KVSFRDFNPVDSYIWFELYGSPSDRDVDLIGSV 211 >ref|XP_002271050.1| PREDICTED: uncharacterized protein LOC100262808 [Vitis vinifera] Length = 297 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDLIGSV Sbjct: 148 KVSFRDFNPVDSYIWFELYGSPSDRDVDLIGSV 180 >ref|XP_010274923.1| PREDICTED: uncharacterized protein LOC104610134 [Nelumbo nucifera] gi|720060628|ref|XP_010274924.1| PREDICTED: uncharacterized protein LOC104610134 [Nelumbo nucifera] Length = 324 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDLIGSV Sbjct: 175 KVSFRDFNPLDSYIWFELYGSPSDRDVDLIGSV 207 >ref|XP_012833090.1| PREDICTED: uncharacterized protein LOC105953963 [Erythranthe guttatus] gi|604341699|gb|EYU40934.1| hypothetical protein MIMGU_mgv1a010311mg [Erythranthe guttata] Length = 316 Score = 70.5 bits (171), Expect = 5e-10 Identities = 35/58 (60%), Positives = 41/58 (70%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSVGACHYGIRQHGLVKM*RLAAGLWSM 381 KVSFRDFNP+DSYIWFEL+GSPSDRDVDL+GS+ Y + + G L G SM Sbjct: 167 KVSFRDFNPLDSYIWFELYGSPSDRDVDLLGSIIQSWYVMGRLGAFNSSNLQLGNSSM 224 >ref|XP_006448505.1| hypothetical protein CICLE_v10015943mg [Citrus clementina] gi|557551116|gb|ESR61745.1| hypothetical protein CICLE_v10015943mg [Citrus clementina] Length = 322 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDLIGSV Sbjct: 173 KVSFRDFNPLDSYIWFELYGSPSDRDVDLIGSV 205 >ref|XP_011091532.1| PREDICTED: uncharacterized protein LOC105171950 isoform X2 [Sesamum indicum] Length = 328 Score = 69.7 bits (169), Expect = 9e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDL+GSV Sbjct: 179 KVSFRDFNPLDSYIWFELYGSPSDRDVDLLGSV 211 >ref|XP_011091531.1| PREDICTED: uncharacterized protein LOC105171950 isoform X1 [Sesamum indicum] Length = 343 Score = 69.7 bits (169), Expect = 9e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDL+GSV Sbjct: 194 KVSFRDFNPLDSYIWFELYGSPSDRDVDLLGSV 226 >emb|CDP16398.1| unnamed protein product [Coffea canephora] Length = 260 Score = 69.7 bits (169), Expect = 9e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+GSPSDRDVDL+GSV Sbjct: 111 KVSFRDFNPLDSYIWFELYGSPSDRDVDLLGSV 143 >ref|XP_009790222.1| PREDICTED: uncharacterized protein LOC104237721 [Nicotiana sylvestris] Length = 304 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSVGACHYGIRQHGLVKM*RLAAG 393 KVSFRDFNP+DSYIWFEL+GSPSDRDV+L+GSV Y I + G L G Sbjct: 155 KVSFRDFNPLDSYIWFELYGSPSDRDVNLLGSVIQAWYVIGRLGAFNSSNLQLG 208 >ref|XP_009125731.1| PREDICTED: uncharacterized protein LOC103850697 [Brassica rapa] Length = 300 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DS+IWFEL+GSPSDRDVDLIGSV Sbjct: 151 KVSFRDFNPVDSFIWFELYGSPSDRDVDLIGSV 183 >emb|CDY60226.1| BnaA03g55710D [Brassica napus] Length = 332 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DS+IWFEL+GSPSDRDVDLIGSV Sbjct: 183 KVSFRDFNPVDSFIWFELYGSPSDRDVDLIGSV 215 >ref|XP_009131064.1| PREDICTED: uncharacterized protein LOC103855782 [Brassica rapa] Length = 328 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DS+IWFEL+GSPSDRDVDLIGS+ Sbjct: 179 KVSFRDFNPVDSFIWFELYGSPSDRDVDLIGSI 211 >ref|XP_010935608.1| PREDICTED: uncharacterized protein LOC105055474 isoform X2 [Elaeis guineensis] Length = 312 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+G+PSDRDVDL+GSV Sbjct: 196 KVSFRDFNPLDSYIWFELYGAPSDRDVDLLGSV 228 >ref|XP_010935607.1| PREDICTED: uncharacterized protein LOC105055474 isoform X1 [Elaeis guineensis] Length = 345 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL+G+PSDRDVDL+GSV Sbjct: 196 KVSFRDFNPLDSYIWFELYGAPSDRDVDLLGSV 228 >gb|KGN51579.1| hypothetical protein Csa_5G580640 [Cucumis sativus] Length = 203 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL GSP+DRDVDLIGSV Sbjct: 111 KVSFRDFNPLDSYIWFELIGSPTDRDVDLIGSV 143 >gb|KFK25208.1| hypothetical protein AALP_AA8G081200 [Arabis alpina] Length = 300 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KV+FRDFNP+DS+IWFEL+GSPSDRDVDLIGSV Sbjct: 151 KVNFRDFNPVDSFIWFELYGSPSDRDVDLIGSV 183 >ref|XP_006468675.1| PREDICTED: uncharacterized protein LOC102611141 [Citrus sinensis] Length = 322 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSF DFNP+DSYIWFEL+GSPSDRDVDLIGSV Sbjct: 173 KVSFTDFNPLDSYIWFELYGSPSDRDVDLIGSV 205 >ref|XP_006399332.1| hypothetical protein EUTSA_v10014240mg [Eutrema salsugineum] gi|557100422|gb|ESQ40785.1| hypothetical protein EUTSA_v10014240mg [Eutrema salsugineum] Length = 296 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KV+FRDFNP+DS+IWFEL+GSPSDRDVDLIGSV Sbjct: 147 KVNFRDFNPVDSFIWFELYGSPSDRDVDLIGSV 179 >ref|XP_004147093.1| PREDICTED: uncharacterized protein LOC101211689 [Cucumis sativus] Length = 310 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 554 KVSFRDFNPIDSYIWFELFGSPSDRDVDLIGSV 456 KVSFRDFNP+DSYIWFEL GSP+DRDVDLIGSV Sbjct: 161 KVSFRDFNPLDSYIWFELIGSPTDRDVDLIGSV 193