BLASTX nr result
ID: Ziziphus21_contig00027652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027652 (589 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFK44842.1| hypothetical protein AALP_AA1G309600 [Arabis alpina] 69 2e-09 ref|XP_007025026.1| Inositol transporter 2 isoform 1 [Theobroma ... 69 2e-09 ref|XP_010087000.1| putative inositol transporter 2 [Morus notab... 68 3e-09 ref|XP_006836360.1| PREDICTED: probable inositol transporter 2 [... 67 5e-09 ref|XP_012072144.1| PREDICTED: probable inositol transporter 2 [... 67 7e-09 ref|XP_013622318.1| PREDICTED: probable inositol transporter 2 [... 66 1e-08 ref|XP_009109608.1| PREDICTED: probable inositol transporter 2 [... 66 1e-08 emb|CDY59231.1| BnaCnng34530D [Brassica napus] 66 1e-08 ref|XP_002278732.1| PREDICTED: probable inositol transporter 2 [... 66 1e-08 emb|CAN62202.1| hypothetical protein VITISV_002203 [Vitis vinifera] 66 1e-08 ref|XP_012455494.1| PREDICTED: probable inositol transporter 2 i... 66 2e-08 ref|XP_012455495.1| PREDICTED: probable inositol transporter 2 i... 66 2e-08 gb|KJB69856.1| hypothetical protein B456_011G046300 [Gossypium r... 66 2e-08 ref|XP_011009749.1| PREDICTED: probable inositol transporter 2 i... 66 2e-08 ref|XP_010247407.1| PREDICTED: probable inositol transporter 2 [... 65 3e-08 ref|XP_010538255.1| PREDICTED: probable inositol transporter 2 [... 64 6e-08 emb|CDX90235.1| BnaA08g17490D [Brassica napus] 64 6e-08 ref|XP_008444543.1| PREDICTED: probable inositol transporter 2 [... 64 6e-08 ref|XP_006415500.1| hypothetical protein EUTSA_v10007189mg [Eutr... 63 1e-07 ref|XP_007213472.1| hypothetical protein PRUPE_ppa023920mg [Prun... 63 1e-07 >gb|KFK44842.1| hypothetical protein AALP_AA1G309600 [Arabis alpina] Length = 580 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH T+ S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHGGTDVSAFRECFSLTWKNPYVLRLAFSAGIGG 38 >ref|XP_007025026.1| Inositol transporter 2 isoform 1 [Theobroma cacao] gi|508780392|gb|EOY27648.1| Inositol transporter 2 isoform 1 [Theobroma cacao] Length = 578 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH T+ S+F +CF+LTW+NPYVLRLAFSAGIGG Sbjct: 1 MEGGIHTGTDASAFKECFSLTWRNPYVLRLAFSAGIGG 38 >ref|XP_010087000.1| putative inositol transporter 2 [Morus notabilis] gi|587834653|gb|EXB25440.1| putative inositol transporter 2 [Morus notabilis] Length = 584 Score = 68.2 bits (165), Expect = 3e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGG+H T+ S+F DCF+L WKNPYVLRLAFSAGIGG Sbjct: 1 MEGGVHPGTDVSAFRDCFSLAWKNPYVLRLAFSAGIGG 38 >ref|XP_006836360.1| PREDICTED: probable inositol transporter 2 [Amborella trichopoda] gi|769820197|ref|XP_011620776.1| PREDICTED: probable inositol transporter 2 [Amborella trichopoda] gi|548838878|gb|ERM99213.1| hypothetical protein AMTR_s00092p00111470 [Amborella trichopoda] Length = 576 Score = 67.4 bits (163), Expect = 5e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH T+ S+F DCF+L W+NPYVLRLAFSAGIGG Sbjct: 1 MEGGIHPGTDASAFRDCFSLAWRNPYVLRLAFSAGIGG 38 >ref|XP_012072144.1| PREDICTED: probable inositol transporter 2 [Jatropha curcas] gi|643730569|gb|KDP38001.1| hypothetical protein JCGZ_04644 [Jatropha curcas] Length = 576 Score = 67.0 bits (162), Expect = 7e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH T+ S+F +CF+L WKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHPGTDASAFRECFSLAWKNPYVLRLAFSAGIGG 38 >ref|XP_013622318.1| PREDICTED: probable inositol transporter 2 [Brassica oleracea var. oleracea] gi|923741564|ref|XP_013671411.1| PREDICTED: probable inositol transporter 2 [Brassica napus] gi|923767890|ref|XP_013678668.1| PREDICTED: probable inositol transporter 2 [Brassica napus] gi|923768179|ref|XP_013678738.1| PREDICTED: probable inositol transporter 2 [Brassica napus] Length = 579 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH + S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHGGADKSAFRECFSLTWKNPYVLRLAFSAGIGG 38 >ref|XP_009109608.1| PREDICTED: probable inositol transporter 2 [Brassica rapa] gi|923691775|ref|XP_013656823.1| PREDICTED: probable inositol transporter 2 [Brassica napus] Length = 579 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH + S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHGGADKSAFRECFSLTWKNPYVLRLAFSAGIGG 38 >emb|CDY59231.1| BnaCnng34530D [Brassica napus] Length = 571 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH + S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHRGADKSAFRECFSLTWKNPYVLRLAFSAGIGG 38 >ref|XP_002278732.1| PREDICTED: probable inositol transporter 2 [Vitis vinifera] gi|297740750|emb|CBI30932.3| unnamed protein product [Vitis vinifera] gi|310877898|gb|ADP37180.1| putative inositol transporter [Vitis vinifera] Length = 577 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH ETS+F DCF+L WKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIH-PVETSAFRDCFSLAWKNPYVLRLAFSAGIGG 37 >emb|CAN62202.1| hypothetical protein VITISV_002203 [Vitis vinifera] Length = 647 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH ETS+F DCF+L WKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIH-PVETSAFRDCFSLAWKNPYVLRLAFSAGIGG 37 >ref|XP_012455494.1| PREDICTED: probable inositol transporter 2 isoform X1 [Gossypium raimondii] Length = 579 Score = 65.9 bits (159), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEG +H T+ S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGVVHTGTDASAFKECFSLTWKNPYVLRLAFSAGIGG 38 >ref|XP_012455495.1| PREDICTED: probable inositol transporter 2 isoform X2 [Gossypium raimondii] gi|763802919|gb|KJB69857.1| hypothetical protein B456_011G046300 [Gossypium raimondii] Length = 578 Score = 65.9 bits (159), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEG +H T+ S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGVVHTGTDASAFKECFSLTWKNPYVLRLAFSAGIGG 38 >gb|KJB69856.1| hypothetical protein B456_011G046300 [Gossypium raimondii] Length = 606 Score = 65.9 bits (159), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEG +H T+ S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGVVHTGTDASAFKECFSLTWKNPYVLRLAFSAGIGG 38 >ref|XP_011009749.1| PREDICTED: probable inositol transporter 2 isoform X1 [Populus euphratica] Length = 578 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = -1 Query: 115 MEGGIHV-TTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH TT S+F DCF+L WKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHTGTTGASAFRDCFSLAWKNPYVLRLAFSAGIGG 39 >ref|XP_010247407.1| PREDICTED: probable inositol transporter 2 [Nelumbo nucifera] Length = 577 Score = 65.1 bits (157), Expect = 3e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH T+ S+F DC +L W+NPYVLRLAFSAGIGG Sbjct: 1 MEGGIHPGTDASAFRDCISLAWRNPYVLRLAFSAGIGG 38 >ref|XP_010538255.1| PREDICTED: probable inositol transporter 2 [Tarenaya hassleriana] Length = 582 Score = 63.9 bits (154), Expect = 6e-08 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = -1 Query: 115 MEGGIHV--TTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH + + S+F +CFALTWKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHGEGSADASAFRECFALTWKNPYVLRLAFSAGIGG 40 >emb|CDX90235.1| BnaA08g17490D [Brassica napus] Length = 570 Score = 63.9 bits (154), Expect = 6e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIG 5 MEGGIH + S+F +CF+LTWKNPYVLRLAFSAGIG Sbjct: 1 MEGGIHGGADKSAFRECFSLTWKNPYVLRLAFSAGIG 37 >ref|XP_008444543.1| PREDICTED: probable inositol transporter 2 [Cucumis melo] Length = 580 Score = 63.9 bits (154), Expect = 6e-08 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 3/41 (7%) Frame = -1 Query: 115 MEGGIHVTTET---SSFTDCFALTWKNPYVLRLAFSAGIGG 2 MEGGIH T T S+F DCF+L WKNPYVLRLAFSAGIGG Sbjct: 1 MEGGIHGGTNTDGSSTFRDCFSLAWKNPYVLRLAFSAGIGG 41 >ref|XP_006415500.1| hypothetical protein EUTSA_v10007189mg [Eutrema salsugineum] gi|557093271|gb|ESQ33853.1| hypothetical protein EUTSA_v10007189mg [Eutrema salsugineum] Length = 579 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 115 MEGGIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 ME GIH + S+F +CF+LTWKNPYVLRLAFSAGIGG Sbjct: 1 MERGIHGGADESAFRECFSLTWKNPYVLRLAFSAGIGG 38 >ref|XP_007213472.1| hypothetical protein PRUPE_ppa023920mg [Prunus persica] gi|462409337|gb|EMJ14671.1| hypothetical protein PRUPE_ppa023920mg [Prunus persica] Length = 577 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 106 GIHVTTETSSFTDCFALTWKNPYVLRLAFSAGIGG 2 GIHV + S+F DCF+L WKNPYVLRLAFSAGIGG Sbjct: 3 GIHVEADASAFRDCFSLAWKNPYVLRLAFSAGIGG 37