BLASTX nr result
ID: Ziziphus21_contig00027650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027650 (220 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010100320.1| hypothetical protein L484_027628 [Morus nota... 68 3e-09 >ref|XP_010100320.1| hypothetical protein L484_027628 [Morus notabilis] gi|587893922|gb|EXB82454.1| hypothetical protein L484_027628 [Morus notabilis] Length = 1284 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -1 Query: 220 EEHDENQHLHNPDSNNLLTCFGITNNTSFAGVDVSLDDYPKEGTSNQNKEIDIPQNHVDL 41 E+ DE + +HNPDS+NLLTC+G+ N S GVD+SLD P +GTS+ N PQ HV+ Sbjct: 105 EKRDEKRLVHNPDSHNLLTCYGLLCNASANGVDLSLDGSPDQGTSDPNNATS-PQKHVER 163 Query: 40 KDNKS 26 K + S Sbjct: 164 KSDVS 168