BLASTX nr result
ID: Ziziphus21_contig00027565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027565 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMS99099.1| hypothetical protein BVRB_3g066970 [Beta vulgaris... 67 5e-09 ref|XP_010693554.1| PREDICTED: rho GDP-dissociation inhibitor 1 ... 67 5e-09 gb|KNA06565.1| hypothetical protein SOVF_179840 [Spinacia oleracea] 66 1e-08 ref|XP_011658122.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 64 4e-08 ref|XP_011658125.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 64 4e-08 ref|XP_010252652.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 64 6e-08 ref|XP_010252650.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 64 6e-08 ref|XP_010042266.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 64 6e-08 ref|XP_009357553.1| PREDICTED: rho GDP-dissociation inhibitor 1 ... 64 6e-08 ref|XP_010052931.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 64 6e-08 ref|XP_012841661.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 63 8e-08 ref|XP_006365854.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 63 8e-08 ref|XP_004239827.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 63 8e-08 ref|XP_011000997.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 63 1e-07 ref|XP_002322530.2| Rho GDP-dissociation inhibitor 1 family prot... 63 1e-07 ref|XP_008455513.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 62 1e-07 ref|XP_004144533.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 62 1e-07 ref|XP_008384134.1| PREDICTED: rho GDP-dissociation inhibitor 1 ... 62 2e-07 ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ri... 62 2e-07 ref|XP_010557776.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 62 2e-07 >gb|KMS99099.1| hypothetical protein BVRB_3g066970 [Beta vulgaris subsp. vulgaris] Length = 213 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDIRKDWLST Sbjct: 182 SYSARTKFLDDDNKCYLEINYTFDIRKDWLST 213 >ref|XP_010693554.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Beta vulgaris subsp. vulgaris] Length = 231 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDIRKDWLST Sbjct: 200 SYSARTKFLDDDNKCYLEINYTFDIRKDWLST 231 >gb|KNA06565.1| hypothetical protein SOVF_179840 [Spinacia oleracea] Length = 229 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SY+ARTKF DDDNKCYLE +YTFDIRKDWLST Sbjct: 198 SYTARTKFLDDDNKCYLEINYTFDIRKDWLST 229 >ref|XP_011658122.1| PREDICTED: rho GDP-dissociation inhibitor 1-like isoform X1 [Cucumis sativus] gi|778720195|ref|XP_011658124.1| PREDICTED: rho GDP-dissociation inhibitor 1-like isoform X1 [Cucumis sativus] Length = 234 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDD+KCYLEF+YTFDIRKDW S+ Sbjct: 203 SYSARTKFVDDDDKCYLEFNYTFDIRKDWQSS 234 >ref|XP_011658125.1| PREDICTED: rho GDP-dissociation inhibitor 1-like isoform X2 [Cucumis sativus] Length = 233 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDD+KCYLEF+YTFDIRKDW S+ Sbjct: 202 SYSARTKFVDDDDKCYLEFNYTFDIRKDWQSS 233 >ref|XP_010252652.1| PREDICTED: rho GDP-dissociation inhibitor 1-like isoform X2 [Nelumbo nucifera] Length = 238 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDI+KDW ST Sbjct: 207 SYSARTKFVDDDNKCYLEINYTFDIKKDWPST 238 >ref|XP_010252650.1| PREDICTED: rho GDP-dissociation inhibitor 1-like isoform X1 [Nelumbo nucifera] Length = 239 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDI+KDW ST Sbjct: 208 SYSARTKFVDDDNKCYLEINYTFDIKKDWPST 239 >ref|XP_010042266.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Eucalyptus grandis] Length = 145 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSAR+KF DDDNKCYLE +YTFDIRKDW ST Sbjct: 113 SYSARSKFVDDDNKCYLEINYTFDIRKDWSST 144 >ref|XP_009357553.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Pyrus x bretschneideri] Length = 245 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSAR+KFADDDNKCYLE +YTFDIRKDW S+ Sbjct: 214 SYSARSKFADDDNKCYLEINYTFDIRKDWQSS 245 >ref|XP_010052931.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Eucalyptus grandis] gi|629112108|gb|KCW77068.1| hypothetical protein EUGRSUZ_D01410 [Eucalyptus grandis] Length = 247 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSAR+KF DDDNKCYLE +YTFDIRKDW ST Sbjct: 215 SYSARSKFVDDDNKCYLEINYTFDIRKDWSST 246 >ref|XP_012841661.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Erythranthe guttatus] gi|848882667|ref|XP_012841662.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Erythranthe guttatus] Length = 236 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDI+KDW ST Sbjct: 205 SYSARTKFVDDDNKCYLEINYTFDIQKDWPST 236 >ref|XP_006365854.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Solanum tuberosum] Length = 233 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDI+K+WL+T Sbjct: 202 SYSARTKFLDDDNKCYLEINYTFDIKKEWLAT 233 >ref|XP_004239827.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Solanum lycopersicum] Length = 233 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDI+K+WL+T Sbjct: 202 SYSARTKFLDDDNKCYLEINYTFDIKKEWLAT 233 >ref|XP_011000997.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Populus euphratica] Length = 257 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SY+AR+KF DDDNKCYLE +YTFDIRKDWL T Sbjct: 224 SYAARSKFVDDDNKCYLEINYTFDIRKDWLPT 255 >ref|XP_002322530.2| Rho GDP-dissociation inhibitor 1 family protein [Populus trichocarpa] gi|550320574|gb|EEF04291.2| Rho GDP-dissociation inhibitor 1 family protein [Populus trichocarpa] Length = 257 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SY+AR+KF DDDNKCYLE +YTFDIRKDWL T Sbjct: 224 SYAARSKFVDDDNKCYLEINYTFDIRKDWLPT 255 >ref|XP_008455513.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis melo] Length = 240 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSAR+KF DDDNKCYLE +YTFDIRKDW +T Sbjct: 209 SYSARSKFLDDDNKCYLEINYTFDIRKDWAAT 240 >ref|XP_004144533.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis sativus] gi|700188213|gb|KGN43446.1| hypothetical protein Csa_7G037500 [Cucumis sativus] Length = 240 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSAR+KF DDDNKCYLE +YTFDIRKDW +T Sbjct: 209 SYSARSKFLDDDNKCYLEINYTFDIRKDWAAT 240 >ref|XP_008384134.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Malus domestica] Length = 245 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSAR+KFADDDNKC+LE +YTFDIRKDW S+ Sbjct: 214 SYSARSKFADDDNKCFLEINYTFDIRKDWQSS 245 >ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] gi|223540220|gb|EEF41793.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] Length = 243 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSAR+KF DDDNKCYLE +YTFDIRK+W ST Sbjct: 212 SYSARSKFVDDDNKCYLEINYTFDIRKEWQST 243 >ref|XP_010557776.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Tarenaya hassleriana] Length = 254 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 367 SYSARTKFADDDNKCYLEFSYTFDIRKDWLST 272 SYSARTKF DDDNKCYLE +YTFDIRK+W +T Sbjct: 223 SYSARTKFLDDDNKCYLEINYTFDIRKEWPAT 254