BLASTX nr result
ID: Ziziphus21_contig00027527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00027527 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitoch... 61 4e-07 ref|XP_009337882.1| PREDICTED: outer envelope protein 64, mitoch... 60 8e-07 ref|XP_008348816.1| PREDICTED: LOW QUALITY PROTEIN: outer envelo... 60 8e-07 ref|XP_008237381.1| PREDICTED: outer envelope protein 64, mitoch... 59 1e-06 ref|XP_007200962.1| hypothetical protein PRUPE_ppa003071mg [Prun... 59 1e-06 ref|XP_012069135.1| PREDICTED: outer envelope protein 64, mitoch... 59 1e-06 ref|XP_009344574.1| PREDICTED: outer envelope protein 64, mitoch... 58 3e-06 gb|KHF99139.1| Amidase 1 -like protein [Gossypium arboreum] 56 9e-06 >ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitochondrial [Vitis vinifera] gi|296086830|emb|CBI32979.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 AAQDFKHALVLEPQNKVANLAEKRLRKLMS Sbjct: 578 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 607 >ref|XP_009337882.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Pyrus x bretschneideri] Length = 611 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 AAQDFKHALVLEPQNKVANLAEKRLRKLM+ Sbjct: 582 AAQDFKHALVLEPQNKVANLAEKRLRKLMT 611 >ref|XP_008348816.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like [Malus domestica] Length = 610 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 AAQDFKHALVLEPQNKVANLAEKRLRKLM+ Sbjct: 581 AAQDFKHALVLEPQNKVANLAEKRLRKLMT 610 >ref|XP_008237381.1| PREDICTED: outer envelope protein 64, mitochondrial [Prunus mume] Length = 607 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 AAQDFKHALVLEPQNKVANLAEKRLR+LMS Sbjct: 578 AAQDFKHALVLEPQNKVANLAEKRLRELMS 607 >ref|XP_007200962.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica] gi|462396362|gb|EMJ02161.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica] Length = 607 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 AAQDFKHALVLEPQNKVANLAEKRLR+LMS Sbjct: 578 AAQDFKHALVLEPQNKVANLAEKRLRELMS 607 >ref|XP_012069135.1| PREDICTED: outer envelope protein 64, mitochondrial [Jatropha curcas] gi|643734058|gb|KDP40901.1| hypothetical protein JCGZ_24900 [Jatropha curcas] Length = 605 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 AAQDFKHALVLEPQNKVA+LAEKRLRKLMS Sbjct: 576 AAQDFKHALVLEPQNKVASLAEKRLRKLMS 605 >ref|XP_009344574.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Pyrus x bretschneideri] Length = 604 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 AAQDFKHALVLEPQNKVA+LAEKRLRKL+S Sbjct: 575 AAQDFKHALVLEPQNKVASLAEKRLRKLLS 604 >gb|KHF99139.1| Amidase 1 -like protein [Gossypium arboreum] Length = 635 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 479 AAQDFKHALVLEPQNKVANLAEKRLRKLMS 390 A +DFKHALVLEPQNKVANLAEKRLRKL+S Sbjct: 606 ALEDFKHALVLEPQNKVANLAEKRLRKLVS 635