BLASTX nr result
ID: Ziziphus21_contig00026940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026940 (214 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009363304.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 78 2e-12 ref|XP_002514422.1| pentatricopeptide repeat-containing protein,... 76 9e-12 ref|XP_008365980.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_009368599.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_008225971.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_007212814.1| hypothetical protein PRUPE_ppa003248mg [Prun... 74 3e-11 gb|KRH57439.1| hypothetical protein GLYMA_05G060900 [Glycine max] 72 2e-10 gb|KHN44080.1| Pentatricopeptide repeat-containing protein, mito... 72 2e-10 ref|XP_006579638.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 gb|KHN43028.1| Pentatricopeptide repeat-containing protein, mito... 70 6e-10 ref|XP_007139543.1| hypothetical protein PHAVU_008G038900g [Phas... 70 6e-10 ref|XP_011035421.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_014497947.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_010092443.1| hypothetical protein L484_019200 [Morus nota... 66 1e-08 ref|XP_002305039.1| pentatricopeptide repeat-containing family p... 65 2e-08 ref|XP_009795704.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 gb|KOM25970.1| hypothetical protein LR48_Vigan211s000500 [Vigna ... 64 6e-08 gb|KOM36832.1| hypothetical protein LR48_Vigan03g021300 [Vigna a... 63 7e-08 ref|XP_010320903.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 >ref|XP_009363304.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Pyrus x bretschneideri] Length = 839 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/68 (52%), Positives = 51/68 (75%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ N+T++AYEL++ L+KQG L + + FK+L KLCME D+DRA+ LL ML Sbjct: 563 SAMVSGYCEANHTKEAYELLIRLAKQGTLVKQGACFKVLSKLCMEGDNDRAILLLEAMLA 622 Query: 25 SNVETTKI 2 NV+ +I Sbjct: 623 LNVDPKRI 630 >ref|XP_002514422.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546418|gb|EEF47918.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 809 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/68 (51%), Positives = 47/68 (69%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ N+ KA+ L++ LSKQG + K S+FKLLG LC E D ++AL LL TM+ Sbjct: 534 SAMVNGYCEANHVNKAFALLIRLSKQGRILKKASFFKLLGNLCSEGDSEKALCLLETMVA 593 Query: 25 SNVETTKI 2 N+ T I Sbjct: 594 LNINPTMI 601 >ref|XP_008365980.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Malus domestica] Length = 840 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/68 (51%), Positives = 50/68 (73%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ N+T++AYEL++ L+KQG L + FK+L KLC+E D+DRA+ LL ML Sbjct: 564 SAMVSGYCEANHTKEAYELLIRLAKQGTLVKQGVCFKVLSKLCVEGDNDRAILLLEAMLA 623 Query: 25 SNVETTKI 2 NV+ +I Sbjct: 624 LNVDPKRI 631 >ref|XP_009368599.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Pyrus x bretschneideri] gi|694385567|ref|XP_009368600.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Pyrus x bretschneideri] gi|694385570|ref|XP_009368601.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Pyrus x bretschneideri] Length = 840 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/68 (50%), Positives = 50/68 (73%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ N+T++AYEL++ L+KQG L + FK+ KLC+E+D+DRA+ LL ML Sbjct: 564 SAMVSGYCEANHTKEAYELLIRLAKQGTLVKQGVCFKVFSKLCIENDNDRAILLLKAMLA 623 Query: 25 SNVETTKI 2 NV+ +I Sbjct: 624 LNVDPKRI 631 >ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Vitis vinifera] gi|731384632|ref|XP_010648206.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Vitis vinifera] Length = 817 Score = 74.7 bits (182), Expect = 2e-11 Identities = 40/68 (58%), Positives = 46/68 (67%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC N TRKAYEL LSKQG L K S FKLL LCME ++D+AL LL ML Sbjct: 542 SAMVDGYCKANFTRKAYELFSRLSKQGILVKKKSCFKLLSSLCMEGEYDKALILLERMLA 601 Query: 25 SNVETTKI 2 +VE +I Sbjct: 602 LDVEPNQI 609 >ref|XP_008225971.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Prunus mume] gi|645239072|ref|XP_008225972.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Prunus mume] gi|645239074|ref|XP_008225973.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Prunus mume] Length = 838 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/67 (55%), Positives = 47/67 (70%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAMI GYC+ +TRKAYEL++ L+K G L K FK+L LC+E D+DRA+ LL +ML Sbjct: 562 SAMISGYCEAKDTRKAYELLIRLAKGGTLVKKGVCFKVLSNLCVEGDNDRAILLLESMLA 621 Query: 25 SNVETTK 5 NVE K Sbjct: 622 LNVEPRK 628 >ref|XP_007212814.1| hypothetical protein PRUPE_ppa003248mg [Prunus persica] gi|462408679|gb|EMJ14013.1| hypothetical protein PRUPE_ppa003248mg [Prunus persica] Length = 589 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/67 (55%), Positives = 47/67 (70%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAMI GYC+ +TRKAYEL++ L+K G L K FK+L LC+E D+DRA+ LL +ML Sbjct: 313 SAMISGYCEAKDTRKAYELLIRLAKGGTLVKKGVCFKVLSNLCVEGDNDRAILLLESMLA 372 Query: 25 SNVETTK 5 NVE K Sbjct: 373 LNVEPRK 379 >gb|KRH57439.1| hypothetical protein GLYMA_05G060900 [Glycine max] Length = 680 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/68 (51%), Positives = 48/68 (70%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ + +K+YE+ + L QG++A K S FKLL KLCM D ++A+ LL ML Sbjct: 527 SAMVNGYCETDLVKKSYEVFLKLLNQGDMAKKASCFKLLSKLCMTGDIEKAVKLLDRMLL 586 Query: 25 SNVETTKI 2 SNVE +KI Sbjct: 587 SNVEPSKI 594 >gb|KHN44080.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 799 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/68 (51%), Positives = 48/68 (70%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ + +K+YE+ + L QG++A K S FKLL KLCM D ++A+ LL ML Sbjct: 525 SAMVNGYCETDLVKKSYEVFLKLLNQGDMAKKASCFKLLSKLCMTGDIEKAVKLLDRMLL 584 Query: 25 SNVETTKI 2 SNVE +KI Sbjct: 585 SNVEPSKI 592 >ref|XP_006579638.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Glycine max] gi|947109112|gb|KRH57438.1| hypothetical protein GLYMA_05G060900 [Glycine max] Length = 801 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/68 (51%), Positives = 48/68 (70%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ + +K+YE+ + L QG++A K S FKLL KLCM D ++A+ LL ML Sbjct: 527 SAMVNGYCETDLVKKSYEVFLKLLNQGDMAKKASCFKLLSKLCMTGDIEKAVKLLDRMLL 586 Query: 25 SNVETTKI 2 SNVE +KI Sbjct: 587 SNVEPSKI 594 >gb|KHN43028.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 900 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/68 (50%), Positives = 48/68 (70%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ + +K+YE+ + L QG++A + S FKLL KLCM D ++A+ LL ML Sbjct: 603 SAMLNGYCETDLVKKSYEVFLKLLNQGDMAKEASCFKLLSKLCMTGDIEKAVKLLERMLL 662 Query: 25 SNVETTKI 2 SNVE +KI Sbjct: 663 SNVEPSKI 670 >ref|XP_007139543.1| hypothetical protein PHAVU_008G038900g [Phaseolus vulgaris] gi|561012676|gb|ESW11537.1| hypothetical protein PHAVU_008G038900g [Phaseolus vulgaris] Length = 803 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/64 (53%), Positives = 46/64 (71%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ N +K+YE+ + LS QGNLA+ S FKLL KLC+ D ++A+ LL ML Sbjct: 530 SAMVNGYCEANLVKKSYEIFLKLSNQGNLANDASCFKLLTKLCLTGDTEKAVMLLERMLL 589 Query: 25 SNVE 14 SNV+ Sbjct: 590 SNVK 593 >ref|XP_011035421.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877524|ref|XP_011035422.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877528|ref|XP_011035423.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877532|ref|XP_011035424.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877534|ref|XP_011035425.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877546|ref|XP_011035426.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877548|ref|XP_011035427.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877552|ref|XP_011035428.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877554|ref|XP_011035429.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877558|ref|XP_011035430.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877562|ref|XP_011035431.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] gi|743877573|ref|XP_011035432.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Populus euphratica] Length = 800 Score = 67.0 bits (162), Expect = 5e-09 Identities = 36/66 (54%), Positives = 44/66 (66%) Frame = -1 Query: 202 AMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLDS 23 AMI GYC+ +T KA EL LS+QG L + +KLL KLC E + DRAL LL TMLD Sbjct: 550 AMITGYCEAKHTEKASELFFELSEQGLLMDRGYIYKLLEKLCEEGEKDRALWLLKTMLDL 609 Query: 22 NVETTK 5 N+E +K Sbjct: 610 NMEPSK 615 >ref|XP_014497947.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Vigna radiata var. radiata] Length = 803 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/68 (48%), Positives = 46/68 (67%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ + +KAYE+ + LS QG++A+ S KL+ KLCM D ++A LL ML Sbjct: 530 SAMVNGYCEADLVKKAYEIFLKLSNQGDMANNTSCSKLITKLCMTGDIEKAKMLLERMLL 589 Query: 25 SNVETTKI 2 SN E +KI Sbjct: 590 SNAEPSKI 597 >ref|XP_010092443.1| hypothetical protein L484_019200 [Morus notabilis] gi|587861355|gb|EXB51209.1| hypothetical protein L484_019200 [Morus notabilis] Length = 798 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/68 (50%), Positives = 44/68 (64%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAMI GYC N TRKAY L++ L KQG + S+ KLL KLC+E +DRA+ L TML Sbjct: 516 SAMISGYCKANYTRKAYALLLRLLKQGIPVGETSFLKLLCKLCVEGQNDRAVFLFETMLA 575 Query: 25 SNVETTKI 2 ++ K+ Sbjct: 576 MKMKPGKV 583 >ref|XP_002305039.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222848003|gb|EEE85550.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 800 Score = 65.5 bits (158), Expect = 2e-08 Identities = 35/66 (53%), Positives = 44/66 (66%) Frame = -1 Query: 202 AMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLDS 23 AMI GYC+ +T KA EL LS++G L + +KLL KLC E + DRAL LL TMLD Sbjct: 550 AMITGYCEAKHTEKASELFFELSERGLLMDRGYIYKLLEKLCEEGEKDRALWLLKTMLDL 609 Query: 22 NVETTK 5 N+E +K Sbjct: 610 NMEPSK 615 >ref|XP_009795704.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] gi|698499818|ref|XP_009795705.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] gi|698499821|ref|XP_009795706.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] gi|698499823|ref|XP_009795707.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] gi|698499825|ref|XP_009795708.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] gi|698499827|ref|XP_009795709.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] Length = 837 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 +AM+ GYC++ NT+ AYEL V LSKQG L + S KLL LC+E ++ +A+ L +L Sbjct: 539 AAMVNGYCELGNTKDAYELFVRLSKQGILIRRNSRLKLLTSLCLEGEYGKAIKLFEIVLT 598 Query: 25 SNVETTKI 2 + +T KI Sbjct: 599 LDDDTCKI 606 >gb|KOM25970.1| hypothetical protein LR48_Vigan211s000500 [Vigna angularis] Length = 845 Score = 63.5 bits (153), Expect = 6e-08 Identities = 32/68 (47%), Positives = 46/68 (67%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+V+ +KAYE+ + L+ QG++A+ S KL+ KLCM D ++A LL ML Sbjct: 530 SAMVNGYCEVDIVKKAYEIFLKLTNQGDMANNASCSKLITKLCMTGDIEKAKMLLERMLL 589 Query: 25 SNVETTKI 2 SN E + I Sbjct: 590 SNAEPSII 597 >gb|KOM36832.1| hypothetical protein LR48_Vigan03g021300 [Vigna angularis] Length = 844 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/68 (47%), Positives = 45/68 (66%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 SAM+ GYC+ + +KAYE+ + LS QG++A+ S KL+ KLCM D ++A LL ML Sbjct: 530 SAMVNGYCEADIVKKAYEIFLKLSNQGDMANNASCSKLITKLCMAGDIEKAKMLLERMLL 589 Query: 25 SNVETTKI 2 SN E + I Sbjct: 590 SNAEPSII 597 >ref|XP_010320903.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial isoform X2 [Solanum lycopersicum] Length = 829 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/68 (45%), Positives = 43/68 (63%) Frame = -1 Query: 205 SAMIGGYCDVNNTRKAYELVVNLSKQGNLASKISYFKLLGKLCMESDHDRALNLLLTMLD 26 +AM+ GYC++ NT+ A+EL V LSKQG L + S KLL LC+E ++ +AL L +L Sbjct: 540 AAMVNGYCELGNTKDAFELFVRLSKQGALIKRKSRLKLLSSLCLEGEYGKALKLFEIVLS 599 Query: 25 SNVETTKI 2 T KI Sbjct: 600 LGDGTCKI 607