BLASTX nr result
ID: Ziziphus21_contig00026778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026778 (228 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008452189.1| PREDICTED: protein STICHEL [Cucumis melo] 58 3e-06 ref|XP_004133740.1| PREDICTED: protein STICHEL [Cucumis sativus]... 58 3e-06 ref|XP_007023787.1| AAA-type ATPase family protein, putative iso... 56 9e-06 ref|XP_007023786.1| AAA-type ATPase family protein, putative iso... 56 9e-06 ref|XP_007023785.1| AAA-type ATPase family protein, putative iso... 56 9e-06 ref|XP_007023784.1| AAA-type ATPase family protein, putative iso... 56 9e-06 >ref|XP_008452189.1| PREDICTED: protein STICHEL [Cucumis melo] Length = 1267 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 198 RVSHPSKFHLKKELTQIRKAARVLRDPGTT 109 RVS PSK HLKKELTQIRKAARVLRDPGTT Sbjct: 5 RVSDPSKLHLKKELTQIRKAARVLRDPGTT 34 >ref|XP_004133740.1| PREDICTED: protein STICHEL [Cucumis sativus] gi|700201158|gb|KGN56291.1| hypothetical protein Csa_3G113330 [Cucumis sativus] Length = 1267 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 198 RVSHPSKFHLKKELTQIRKAARVLRDPGTT 109 RVS PSK HLKKELTQIRKAARVLRDPGTT Sbjct: 5 RVSDPSKLHLKKELTQIRKAARVLRDPGTT 34 >ref|XP_007023787.1| AAA-type ATPase family protein, putative isoform 4 [Theobroma cacao] gi|508779153|gb|EOY26409.1| AAA-type ATPase family protein, putative isoform 4 [Theobroma cacao] Length = 1368 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 198 RVSHPSKFHLKKELTQIRKAARVLRDPGTT 109 R+S PS+ HLKKELTQIRKAARVLRDPGTT Sbjct: 5 RISDPSRLHLKKELTQIRKAARVLRDPGTT 34 >ref|XP_007023786.1| AAA-type ATPase family protein, putative isoform 3 [Theobroma cacao] gi|508779152|gb|EOY26408.1| AAA-type ATPase family protein, putative isoform 3 [Theobroma cacao] Length = 1333 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 198 RVSHPSKFHLKKELTQIRKAARVLRDPGTT 109 R+S PS+ HLKKELTQIRKAARVLRDPGTT Sbjct: 5 RISDPSRLHLKKELTQIRKAARVLRDPGTT 34 >ref|XP_007023785.1| AAA-type ATPase family protein, putative isoform 2 [Theobroma cacao] gi|508779151|gb|EOY26407.1| AAA-type ATPase family protein, putative isoform 2 [Theobroma cacao] Length = 1298 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 198 RVSHPSKFHLKKELTQIRKAARVLRDPGTT 109 R+S PS+ HLKKELTQIRKAARVLRDPGTT Sbjct: 5 RISDPSRLHLKKELTQIRKAARVLRDPGTT 34 >ref|XP_007023784.1| AAA-type ATPase family protein, putative isoform 1 [Theobroma cacao] gi|508779150|gb|EOY26406.1| AAA-type ATPase family protein, putative isoform 1 [Theobroma cacao] Length = 1332 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 198 RVSHPSKFHLKKELTQIRKAARVLRDPGTT 109 R+S PS+ HLKKELTQIRKAARVLRDPGTT Sbjct: 5 RISDPSRLHLKKELTQIRKAARVLRDPGTT 34