BLASTX nr result
ID: Ziziphus21_contig00026686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026686 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008337494.1| PREDICTED: DNA topoisomerase 3-beta-1 isofor... 57 4e-06 >ref|XP_008337494.1| PREDICTED: DNA topoisomerase 3-beta-1 isoform X1 [Malus domestica] Length = 862 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 100 STNKVLMVAEKPSIALSIASTLSHGRMSTRKGS 2 ++NKVLMVAEKPSIALSIAS LSHG+MSTR+GS Sbjct: 2 ASNKVLMVAEKPSIALSIASVLSHGQMSTRRGS 34