BLASTX nr result
ID: Ziziphus21_contig00026654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026654 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011654120.1| PREDICTED: uncharacterized protein LOC105435... 57 7e-06 >ref|XP_011654120.1| PREDICTED: uncharacterized protein LOC105435303 [Cucumis sativus] gi|700209768|gb|KGN64864.1| hypothetical protein Csa_1G132740 [Cucumis sativus] Length = 215 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 2/67 (2%) Frame = -1 Query: 379 VVVMCVAMGTIWAVVQPRRPKVVVENGYFTNASLSYYNTT--LSGKLYFNISFYNPNKKA 206 ++++ +A+ T W VV PR P+++VE+G T Y++T L+ + FNI YNPNK+A Sbjct: 52 IMLLGIAILTCWFVVIPRTPQLMVESGQVTG----YHSTIRKLNATIVFNIRSYNPNKRA 107 Query: 205 TIYVDSL 185 +IYVDS+ Sbjct: 108 SIYVDSM 114