BLASTX nr result
ID: Ziziphus21_contig00026580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026580 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_008442345.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_008244810.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_008363930.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 gb|KDO63309.1| hypothetical protein CISIN_1g039177mg [Citrus sin... 64 3e-08 ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citr... 64 3e-08 ref|XP_009373117.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 4e-08 ref|XP_002309173.2| pentatricopeptide repeat-containing family p... 64 4e-08 ref|XP_010091108.1| hypothetical protein L484_021993 [Morus nota... 63 1e-07 ref|XP_011019040.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_011466430.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_012089729.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_007138368.1| hypothetical protein PHAVU_009G202600g [Phas... 59 2e-06 ref|XP_014496627.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_010683568.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis sativus] gi|778683089|ref|XP_011651840.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis sativus] gi|700203575|gb|KGN58708.1| hypothetical protein Csa_3G730720 [Cucumis sativus] Length = 491 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -3 Query: 159 RLLNCTASPPKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIP 4 R+L A+P +P LLSAL+ SFT+Y C P P Y+FV+KTL +TSQFHHIP Sbjct: 41 RILKQAANPDQPHLLLSALVTSFTAYSCHPTPNAYYFVLKTLARTSQFHHIP 92 >ref|XP_008442345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083418|ref|XP_008442346.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083420|ref|XP_008442347.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083422|ref|XP_008442348.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083424|ref|XP_008442349.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] Length = 490 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -3 Query: 159 RLLNCTASPPKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIP 4 R+L +A+ +P LLS LI SFTSY C P P Y+FV+KTL +TSQFHHIP Sbjct: 40 RILKQSANSHQPHLLLSTLITSFTSYSCHPTPNAYYFVLKTLARTSQFHHIP 91 >ref|XP_008244810.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Prunus mume] Length = 490 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = -3 Query: 141 ASPPK--PDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHI 7 +SPP+ P HLLS LI+SF SY C+P PE Y+FVIKTLTKTSQF+ I Sbjct: 46 SSPPQNQPQHLLSTLIYSFNSYNCEPNPEAYNFVIKTLTKTSQFNDI 92 >ref|XP_008363930.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Malus domestica] Length = 491 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -3 Query: 138 SPPKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHI 7 S P P HLL LI+SF +Y DP PE YHFV+KTLTKTSQF HI Sbjct: 46 SLPPPCHLLPTLIYSFKTYNVDPTPEAYHFVLKTLTKTSQFDHI 89 >gb|KDO63309.1| hypothetical protein CISIN_1g039177mg [Citrus sinensis] Length = 453 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 132 PKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQF 16 PK H+LS+L+HSF+ Y C+PPPE YHFVIKTL + SQF Sbjct: 58 PKQPHILSSLLHSFSIYNCEPPPEAYHFVIKTLAENSQF 96 >ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] gi|557531581|gb|ESR42764.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] Length = 506 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 132 PKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQF 16 PK H+LS+L+HSF+ Y C+PPPE YHFVIKTL + SQF Sbjct: 58 PKQPHILSSLLHSFSIYNCEPPPEAYHFVIKTLAENSQF 96 >ref|XP_009373117.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Pyrus x bretschneideri] Length = 491 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -3 Query: 138 SPPKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHI 7 S P P HLL LI+SF +Y DP PE YHF +KTLTKTSQF HI Sbjct: 46 SLPAPCHLLPTLIYSFKTYNADPTPEAYHFFLKTLTKTSQFDHI 89 >ref|XP_002309173.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550335936|gb|EEE92696.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 490 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 138 SPPKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIP 4 SP KP HLLS+LIHSF+ Y +P P+ + F+ KTL KTSQFHHIP Sbjct: 54 SPNKP-HLLSSLIHSFSIYDVEPAPKAFDFIFKTLVKTSQFHHIP 97 >ref|XP_010091108.1| hypothetical protein L484_021993 [Morus notabilis] gi|587852268|gb|EXB42398.1| hypothetical protein L484_021993 [Morus notabilis] Length = 494 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 126 PDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHI 7 P+ LLS L++SF SY C+P PE YHFV+KTL KTSQF HI Sbjct: 49 PNRLLSLLLNSFNSYDCNPTPEAYHFVLKTLIKTSQFDHI 88 >ref|XP_011019040.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Populus euphratica] gi|743811542|ref|XP_011019042.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Populus euphratica] Length = 506 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -3 Query: 138 SPPKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIP 4 SP KP HLLS+LIHSF Y +P P+ + F+ KTL KTSQFHHIP Sbjct: 54 SPHKP-HLLSSLIHSFGIYDVEPTPKAFDFIFKTLVKTSQFHHIP 97 >ref|XP_011466430.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Fragaria vesca subsp. vesca] Length = 491 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 126 PDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIP 4 P LLS LIHSF ++ CDP PE Y+FV+KTL KTSQ HIP Sbjct: 51 PQTLLSTLIHSFNTFNCDPTPEAYNFVLKTLFKTSQLSHIP 91 >ref|XP_012089729.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761267|ref|XP_012089731.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761270|ref|XP_012089732.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761273|ref|XP_012089733.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761276|ref|XP_012089734.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|643706993|gb|KDP22803.1| hypothetical protein JCGZ_00390 [Jatropha curcas] Length = 500 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -3 Query: 129 KPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIPL 1 K +LLS+LIHSF+ Y +P P+ +HF+IKTLT+T+Q H+IPL Sbjct: 57 KSSNLLSSLIHSFSVYNSEPTPQAFHFLIKTLTETTQLHYIPL 99 >ref|XP_007138368.1| hypothetical protein PHAVU_009G202600g [Phaseolus vulgaris] gi|561011455|gb|ESW10362.1| hypothetical protein PHAVU_009G202600g [Phaseolus vulgaris] Length = 513 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/51 (56%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = -3 Query: 153 LNCTASPPKPD-HLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIP 4 + C +P P LLS LI SF SY CDP P+ Y+F+IKTLT TSQF IP Sbjct: 49 MGCPQTPNLPHPFLLSTLIDSFKSYSCDPTPKAYYFLIKTLTCTSQFQDIP 99 >ref|XP_014496627.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Vigna radiata var. radiata] gi|950955388|ref|XP_014496628.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Vigna radiata var. radiata] Length = 499 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -3 Query: 144 TASPPKPDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHIP 4 TA+ P P LLS L+ SF +Y CDP P+ Y+FVIKTLT TSQ IP Sbjct: 57 TANLPHP-FLLSTLLDSFKAYSCDPTPKAYYFVIKTLTNTSQLQDIP 102 >ref|XP_010683568.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris] gi|870854858|gb|KMT06606.1| hypothetical protein BVRB_7g157740 [Beta vulgaris subsp. vulgaris] Length = 509 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -3 Query: 144 TASPPK-PDHLLSALIHSFTSYQCDPPPETYHFVIKTLTKTSQFHHI 7 T +PPK P HLL+ LI+SF SYQCDP Y+FVIKTL + SQF + Sbjct: 61 TQNPPKTPSHLLNCLINSFASYQCDPTLCAYNFVIKTLIQKSQFSEL 107