BLASTX nr result
ID: Ziziphus21_contig00026559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026559 (228 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112247.1| HVA22-like protein a [Morus notabilis] gi|58... 62 2e-07 >ref|XP_010112247.1| HVA22-like protein a [Morus notabilis] gi|587946675|gb|EXC33003.1| HVA22-like protein a [Morus notabilis] Length = 514 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = +2 Query: 2 EKNEVKALKQGSRVQPNVTRVENRNFVGPEIKKPVPEGATQRELPETPSSSKGQK-WTCE 178 EKN+VK Q +R +P +T+ +N+ + E ++ V E RELPETP S QK WTC Sbjct: 250 EKNQVKETSQVNRGEPQLTQTKNKTALPTETREKVSEVQAGRELPETPVSRIVQKEWTCA 309 Query: 179 ICNITMQDVTTFNTHL 226 IC +T + F +HL Sbjct: 310 ICQVTTESEADFISHL 325