BLASTX nr result
ID: Ziziphus21_contig00026418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026418 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009359812.1| PREDICTED: putative SMARCAL1-like protein is... 57 4e-06 ref|XP_007225110.1| hypothetical protein PRUPE_ppa002731mg [Prun... 57 4e-06 >ref|XP_009359812.1| PREDICTED: putative SMARCAL1-like protein isoform X3 [Pyrus x bretschneideri] Length = 760 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 106 TMNLEDDDWELSAEQLDSLEKDAFNKIAQQRLN 8 TM LEDDDW+LSAE+ DSLE+DAF K+AQQR+N Sbjct: 31 TMALEDDDWDLSAEEFDSLERDAFQKLAQQRVN 63 >ref|XP_007225110.1| hypothetical protein PRUPE_ppa002731mg [Prunus persica] gi|462422046|gb|EMJ26309.1| hypothetical protein PRUPE_ppa002731mg [Prunus persica] Length = 639 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 103 MNLEDDDWELSAEQLDSLEKDAFNKIAQQRLN 8 M LEDDDW+LSAE+LDSLE+DAF K+AQQR+N Sbjct: 1 MALEDDDWDLSAEELDSLERDAFQKLAQQRIN 32