BLASTX nr result
ID: Ziziphus21_contig00026332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026332 (211 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300553.2| hypothetical protein POPTR_0001s46420g [Popu... 63 8e-08 ref|XP_010098509.1| hypothetical protein L484_025948 [Morus nota... 61 3e-07 ref|XP_011005325.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_011005323.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_002300553.2| hypothetical protein POPTR_0001s46420g [Populus trichocarpa] gi|550350020|gb|EEE85358.2| hypothetical protein POPTR_0001s46420g [Populus trichocarpa] Length = 1112 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = -3 Query: 200 GSDGVLEKEFEFKPSFDEYLKVMESVRTVKDRNQGIGSKEQKSMKGLKDKVEGN 39 GS GV+EKEFEFKPSF EYLK MESV+T +++NQ S K LKD +EGN Sbjct: 22 GSGGVIEKEFEFKPSFGEYLKAMESVKTGREKNQVHKSNSSK----LKDDLEGN 71 >ref|XP_010098509.1| hypothetical protein L484_025948 [Morus notabilis] gi|587886364|gb|EXB75169.1| hypothetical protein L484_025948 [Morus notabilis] Length = 884 Score = 61.2 bits (147), Expect = 3e-07 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 8/66 (12%) Frame = -3 Query: 203 GGSDG------VLEKEFEFKPSFDEYLKVMESVRTVKDRNQGIGSKEQKSMKGLKDKV-- 48 GGSD +LEKEFEFKPSFD+YLKVMESVRTV+D K+QKS L++ Sbjct: 67 GGSDSKLVGGSLLEKEFEFKPSFDDYLKVMESVRTVRD-------KKQKSTHNLRETFLS 119 Query: 47 EGNAEN 30 EGN E+ Sbjct: 120 EGNEES 125 >ref|XP_011005325.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Populus euphratica] Length = 1025 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = -3 Query: 200 GSDGVLEKEFEFKPSFDEYLKVMESVRTVKDRNQGIGSKEQKSMKGLKDKVEGN 39 G GV+EKE EFKPSF EYLK MESV+T +++NQ S K LKD +EGN Sbjct: 78 GGGGVIEKELEFKPSFGEYLKAMESVKTGREKNQVHKSNSYK----LKDDLEGN 127 >ref|XP_011005323.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Populus euphratica] gi|743922503|ref|XP_011005324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Populus euphratica] Length = 1142 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = -3 Query: 200 GSDGVLEKEFEFKPSFDEYLKVMESVRTVKDRNQGIGSKEQKSMKGLKDKVEGN 39 G GV+EKE EFKPSF EYLK MESV+T +++NQ S K LKD +EGN Sbjct: 78 GGGGVIEKELEFKPSFGEYLKAMESVKTGREKNQVHKSNSYK----LKDDLEGN 127