BLASTX nr result
ID: Ziziphus21_contig00026112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00026112 (205 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006467469.1| PREDICTED: uncharacterized protein LOC102614... 60 6e-07 ref|XP_010110971.1| hypothetical protein L484_021665 [Morus nota... 57 7e-06 >ref|XP_006467469.1| PREDICTED: uncharacterized protein LOC102614771 [Citrus sinensis] Length = 262 Score = 60.1 bits (144), Expect = 6e-07 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = +1 Query: 58 VPKIFGNFAIKTKYGALAATATPFVVFGGVYIAWAYLNQAWQRRKD 195 + +F N I TKYGA+A TATP V+F Y+AWAY ++AW++ K+ Sbjct: 16 IANLFTNITINTKYGAMAVTATPVVIFASFYVAWAYTSRAWRKHKN 61 >ref|XP_010110971.1| hypothetical protein L484_021665 [Morus notabilis] gi|587942821|gb|EXC29357.1| hypothetical protein L484_021665 [Morus notabilis] Length = 270 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +1 Query: 76 NFAIKTKYGALAATATPFVVFGGVYIAWAYLNQAWQRRKDEQR 204 N +KT+YG +AATA P ++ GG YI AYLN+ W RRK + R Sbjct: 9 NITVKTRYGVVAATAIPLIIIGGAYIVSAYLNRGWGRRKGQAR 51