BLASTX nr result
ID: Ziziphus21_contig00025813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025813 (400 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112894.1| hypothetical protein L484_017730 [Morus nota... 68 3e-09 >ref|XP_010112894.1| hypothetical protein L484_017730 [Morus notabilis] gi|587948790|gb|EXC35029.1| hypothetical protein L484_017730 [Morus notabilis] Length = 1859 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 177 SMDLPLRGEGPAILQLQRWGPSHPQLNLSEFREAFI 70 +MDLPL GEG AILQLQ+WGPSHP+LNLSEFREAFI Sbjct: 74 TMDLPLDGEGLAILQLQKWGPSHPKLNLSEFREAFI 109