BLASTX nr result
ID: Ziziphus21_contig00025754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025754 (467 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea ma... 64 4e-08 ref|XP_008666922.1| PREDICTED: uncharacterized protein LOC100272... 64 4e-08 ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 4e-08 ref|XP_008666941.1| PREDICTED: uncharacterized protein LOC100272... 64 4e-08 ref|XP_008666933.1| PREDICTED: uncharacterized protein LOC100272... 64 4e-08 gb|KNA08715.1| hypothetical protein SOVF_160160, partial [Spinac... 64 6e-08 ref|XP_012459036.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 ref|XP_012459037.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 ref|XP_012459035.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 gb|KHG16037.1| Peptidyl-prolyl cis-trans isomerase FKBP19, chlor... 64 6e-08 ref|XP_008797139.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 ref|XP_008797138.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 ref|XP_008797137.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 gb|KDO58143.1| hypothetical protein CISIN_1g038431mg [Citrus sin... 64 6e-08 ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 64 6e-08 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 64 6e-08 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 64 6e-08 ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 64 6e-08 ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 64 6e-08 >ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea mays] gi|670358760|ref|XP_008666916.1| PREDICTED: uncharacterized protein LOC100272703 isoform X1 [Zea mays] gi|194700240|gb|ACF84204.1| unknown [Zea mays] gi|414870311|tpg|DAA48868.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870312|tpg|DAA48869.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 240 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 372 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 209 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 240 >ref|XP_008666922.1| PREDICTED: uncharacterized protein LOC100272703 isoform X2 [Zea mays] gi|670358764|ref|XP_008666926.1| PREDICTED: uncharacterized protein LOC100272703 isoform X2 [Zea mays] gi|194696764|gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK506 binding protein [Zea mays] gi|414870313|tpg|DAA48870.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870314|tpg|DAA48871.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 232 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 372 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 201 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 232 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic [Setaria italica] gi|944232195|gb|KQK96557.1| hypothetical protein SETIT_011042mg [Setaria italica] Length = 214 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 372 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 183 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >ref|XP_008666941.1| PREDICTED: uncharacterized protein LOC100272703 isoform X4 [Zea mays] gi|414870317|tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 198 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 372 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 167 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 198 >ref|XP_008666933.1| PREDICTED: uncharacterized protein LOC100272703 isoform X3 [Zea mays] gi|414870315|tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|414870316|tpg|DAA48873.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Zea mays] Length = 214 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 372 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 183 GQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >gb|KNA08715.1| hypothetical protein SOVF_160160, partial [Spinacia oleracea] Length = 134 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 104 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 134 >ref|XP_012459036.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X2 [Gossypium raimondii] gi|763810296|gb|KJB77198.1| hypothetical protein B456_012G126000 [Gossypium raimondii] Length = 220 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 190 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 220 >ref|XP_012459037.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X3 [Gossypium raimondii] gi|763810295|gb|KJB77197.1| hypothetical protein B456_012G126000 [Gossypium raimondii] Length = 205 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 175 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 205 >ref|XP_012459035.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X1 [Gossypium raimondii] gi|763810292|gb|KJB77194.1| hypothetical protein B456_012G126000 [Gossypium raimondii] gi|763810297|gb|KJB77199.1| hypothetical protein B456_012G126000 [Gossypium raimondii] gi|763810298|gb|KJB77200.1| hypothetical protein B456_012G126000 [Gossypium raimondii] Length = 247 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 217 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 247 >gb|KHG16037.1| Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic -like protein [Gossypium arboreum] Length = 247 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 217 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 247 >ref|XP_008797139.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X3 [Phoenix dactylifera] Length = 230 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 200 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 230 >ref|XP_008797138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X2 [Phoenix dactylifera] Length = 242 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 212 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 242 >ref|XP_008797137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X1 [Phoenix dactylifera] Length = 257 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 227 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 257 >gb|KDO58143.1| hypothetical protein CISIN_1g038431mg [Citrus sinensis] Length = 267 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 237 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] gi|947052158|gb|KRH01687.1| hypothetical protein GLYMA_18G292600 [Glycine max] Length = 242 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 212 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 242 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 237 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 220 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 250 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 237 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] gi|508707703|gb|EOX99599.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] Length = 255 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 225 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 255 >ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] gi|508707702|gb|EOX99598.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] Length = 249 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 467 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 375 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 219 GQRALDFVLRNQGLIDKTLLFDIELLKIIPN 249