BLASTX nr result
ID: Ziziphus21_contig00025737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025737 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205664.1| hypothetical protein PRUPE_ppa009465mg [Prun... 151 2e-34 ref|XP_008244810.1| PREDICTED: pentatricopeptide repeat-containi... 149 8e-34 ref|XP_008363930.1| PREDICTED: pentatricopeptide repeat-containi... 145 1e-32 ref|XP_011466430.1| PREDICTED: pentatricopeptide repeat-containi... 140 3e-31 ref|XP_009373117.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 138 2e-30 ref|XP_010091108.1| hypothetical protein L484_021993 [Morus nota... 132 1e-28 ref|XP_007026524.1| Pentatricopeptide repeat superfamily protein... 119 9e-25 ref|XP_002265961.2| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 gb|AHB18409.1| pentatricopeptide repeat-containing protein [Goss... 116 7e-24 ref|XP_011019040.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_012468563.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_002533822.1| pentatricopeptide repeat-containing protein,... 114 3e-23 gb|KDO63309.1| hypothetical protein CISIN_1g039177mg [Citrus sin... 114 4e-23 ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citr... 114 4e-23 ref|XP_007140168.1| hypothetical protein PHAVU_008G089500g [Phas... 107 3e-21 ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_014496627.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_012089729.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_003623530.2| PPR containing plant-like protein [Medicago ... 105 1e-20 ref|XP_008442345.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 >ref|XP_007205664.1| hypothetical protein PRUPE_ppa009465mg [Prunus persica] gi|462401306|gb|EMJ06863.1| hypothetical protein PRUPE_ppa009465mg [Prunus persica] Length = 291 Score = 151 bits (382), Expect = 2e-34 Identities = 73/109 (66%), Positives = 88/109 (80%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+EL+ +M KG+ VN QT+RIMLDGLF GD++EAC+ M+EMLDK LC C +FDE+IY Sbjct: 177 ARELVSEMTLKGIGVNLQTHRIMLDGLFGQGDIDEACIFMDEMLDKFLCRFCSSFDEVIY 236 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANWT 132 GLC++GLVCKA DLLK MV KNVAPGA+AWEALLLSS S+ AE WT Sbjct: 237 GLCRKGLVCKAMDLLKKMVDKNVAPGAKAWEALLLSSGSEPGFAETTWT 285 >ref|XP_008244810.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Prunus mume] Length = 490 Score = 149 bits (376), Expect = 8e-34 Identities = 72/109 (66%), Positives = 87/109 (79%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+EL+ +M KG+ VN QT+RIMLDGLF GD++EAC+ M+EMLDK LC C +FDE+IY Sbjct: 376 ARELVSEMTLKGIGVNLQTHRIMLDGLFGQGDIDEACIFMDEMLDKFLCRFCSSFDEVIY 435 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANWT 132 GLC++G VCKA DLLK MV KNVAPGA+AWEALLLSS S+ AE WT Sbjct: 436 GLCRKGSVCKAMDLLKKMVDKNVAPGAKAWEALLLSSGSEPGFAETTWT 484 >ref|XP_008363930.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Malus domestica] Length = 491 Score = 145 bits (365), Expect = 1e-32 Identities = 72/109 (66%), Positives = 85/109 (77%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+ LM +M GV VN QTYRIMLDGLF GD+ EACV MEEMLDK + H C +FD++IY Sbjct: 373 ARNLMREMTLNGVGVNLQTYRIMLDGLFGKGDIEEACVFMEEMLDKVIVHFCSSFDKVIY 432 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANWT 132 GLCQRGLVCKA +LLK MV KNVAP ++AWEALLLSS S+ ++ E WT Sbjct: 433 GLCQRGLVCKAMELLKKMVAKNVAPRSKAWEALLLSSGSEPSLEETTWT 481 >ref|XP_011466430.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Fragaria vesca subsp. vesca] Length = 491 Score = 140 bits (354), Expect = 3e-31 Identities = 69/109 (63%), Positives = 83/109 (76%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+EL+ +M GV VN QT+ IMLDGLF GD++EAC+ MEEMLDK +C +C +D++IY Sbjct: 374 ARELVSEMTLNGVGVNLQTHIIMLDGLFCKGDVDEACIFMEEMLDKFMCRRCSAYDDVIY 433 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANWT 132 GLCQRGLVCKA DLL MV KNV PGARAWEALLLSS + + E WT Sbjct: 434 GLCQRGLVCKAMDLLLKMVDKNVVPGARAWEALLLSSGTGPCLVENTWT 482 >ref|XP_009373117.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Pyrus x bretschneideri] Length = 491 Score = 138 bits (347), Expect = 2e-30 Identities = 70/108 (64%), Positives = 81/108 (75%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+ LM +M GV VN QTYRIML+GLF GD+ EACV MEEMLDK L C +FD +IY Sbjct: 373 ARNLMREMTLNGVGVNLQTYRIMLEGLFGKGDIEEACVFMEEMLDKVLVCFCSSFDVVIY 432 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANW 135 GLCQRGLVCKA +LLK MV K V PGA+AWEALLLSS S+ ++ E W Sbjct: 433 GLCQRGLVCKATELLKKMVAKKVDPGAKAWEALLLSSGSEHSLEETTW 480 >ref|XP_010091108.1| hypothetical protein L484_021993 [Morus notabilis] gi|587852268|gb|EXB42398.1| hypothetical protein L484_021993 [Morus notabilis] Length = 494 Score = 132 bits (331), Expect = 1e-28 Identities = 67/109 (61%), Positives = 81/109 (74%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 AKEL+ +M KG QTY IMLD L G++ EAC LMEEMLDK LC +C +DEII+ Sbjct: 375 AKELVAEMSLKGFEDYLQTYIIMLDVLLGKGEIVEACGLMEEMLDKLLCRRCSMYDEIIF 434 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANWT 132 GLC+RGL CKA ++L MVGKNVAPGARAW+ALLLSS S+ + EA W+ Sbjct: 435 GLCRRGLDCKASEMLGKMVGKNVAPGARAWDALLLSSGSELTLPEAIWS 483 >ref|XP_007026524.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508715129|gb|EOY07026.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 542 Score = 119 bits (298), Expect = 9e-25 Identities = 59/104 (56%), Positives = 77/104 (74%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A EL+ +M KG+ +N +Y +++DGL G++ EA L+EE+L K CH+ L FDE+I Sbjct: 421 AMELVKEMKYKGIEMNLVSYTVIIDGLVSKGEILEAHGLVEEVLHKCFCHQSLAFDEVIC 480 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVA 147 GLCQRGLVC+A +LL+ MV KNV+PGAR WEALLLSS SK N A Sbjct: 481 GLCQRGLVCEALELLRKMVAKNVSPGARGWEALLLSSESKINFA 524 >ref|XP_002265961.2| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Vitis vinifera] Length = 507 Score = 119 bits (297), Expect = 1e-24 Identities = 63/108 (58%), Positives = 80/108 (74%) Frame = -3 Query: 455 KELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIYG 276 +EL +M+ +GV+ N +TYRIMLDGL G+++E+C L+EEMLDK+ C TFDEII Sbjct: 383 RELAREMELEGVQWNWETYRIMLDGLVGKGEIDESCSLLEEMLDKYFSCWCSTFDEIICE 442 Query: 275 LCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANWT 132 LCQRGLVCKA L+ MV K +APGARAWEALLL S +F+ AE + T Sbjct: 443 LCQRGLVCKALQLVNKMVRKTIAPGARAWEALLLGS-VEFSFAETSLT 489 >gb|AHB18409.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum] Length = 480 Score = 116 bits (290), Expect = 7e-24 Identities = 57/100 (57%), Positives = 77/100 (77%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+EL+ +M KG+ +N +Y I++DGL NG++ EAC L+EE+L K + K LTFDE+I Sbjct: 372 ARELVKEMKYKGIEMNWVSYTIIIDGLVSNGEILEACALVEEVLHKCIFIKSLTFDEVIC 431 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSK 159 GLCQRGLVCKA +LL MV ++++PGAR WEALLLSS S+ Sbjct: 432 GLCQRGLVCKARELLGKMVERSISPGARVWEALLLSSESR 471 >ref|XP_011019040.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Populus euphratica] gi|743811542|ref|XP_011019042.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Populus euphratica] Length = 506 Score = 115 bits (289), Expect = 1e-23 Identities = 62/105 (59%), Positives = 75/105 (71%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A +L+ +M KG+ +N QTYRIM+DGL NG + EAC L EE LDK LC + L DEII Sbjct: 380 AGDLVREMGVKGIGLNMQTYRIMIDGLASNGKIVEACGLFEEALDKRLCTQRLLLDEIIC 439 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAE 144 GL R L CKA +LL+ MVGKNV+PGARAW+ALLLSS K + E Sbjct: 440 GLGDRDLSCKALELLEKMVGKNVSPGARAWKALLLSSGFKLDCVE 484 >ref|XP_012468563.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Gossypium raimondii] gi|763749710|gb|KJB17149.1| hypothetical protein B456_002G267400 [Gossypium raimondii] Length = 480 Score = 115 bits (288), Expect = 1e-23 Identities = 57/100 (57%), Positives = 77/100 (77%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+EL+ +M KG+ +N +Y I++DGL NG++ EAC L+EE+L K + K LTFDE+I Sbjct: 372 ARELVKEMKYKGIEMNWVSYTIIIDGLVSNGEILEACALVEEVLHKCIFIKSLTFDEVIC 431 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSK 159 GLCQRGLVCKA +LL MV ++++PGAR WEALLLSS S+ Sbjct: 432 GLCQRGLVCKALELLGKMVERSISPGARVWEALLLSSESR 471 >ref|XP_002533822.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526239|gb|EEF28557.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 373 Score = 114 bits (285), Expect = 3e-23 Identities = 56/122 (45%), Positives = 78/122 (63%), Gaps = 3/122 (2%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A++L+ M SKG+ + QTY++M+ GL G + +AC L+EE LDK LC + L FDE+IY Sbjct: 252 ARDLVRDMGSKGIGLGMQTYKVMIHGLTSGGKIVKACSLLEEALDKGLCPRGLRFDEVIY 311 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKF---NVAEANWTCENNGNCP 108 GLCQ G +CKA +LL+ +V KNV+PG R WE LLL S F + W E + +C Sbjct: 312 GLCQTGSICKALELLEKVVNKNVSPGVRVWETLLLKSNINFVEDTFIDLVWVWETHPHCQ 371 Query: 107 GR 102 + Sbjct: 372 NK 373 >gb|KDO63309.1| hypothetical protein CISIN_1g039177mg [Citrus sinensis] Length = 453 Score = 114 bits (284), Expect = 4e-23 Identities = 60/107 (56%), Positives = 76/107 (71%) Frame = -3 Query: 455 KELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIYG 276 +EL+ +M KG+ +N QTY IM+DGL GD+ EAC L+EE L+K LC + FDE I G Sbjct: 331 RELVKEMKWKGIVLNLQTYSIMIDGLASKGDIIEACGLLEEALNKGLCTQSSMFDETICG 390 Query: 275 LCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANW 135 LCQRGLV KA +LLK M K+V+PGAR WEALLLSS SK + ++ Sbjct: 391 LCQRGLVRKALELLKQMADKDVSPGARVWEALLLSSVSKLDFVNTSF 437 >ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] gi|557531581|gb|ESR42764.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] Length = 506 Score = 114 bits (284), Expect = 4e-23 Identities = 60/107 (56%), Positives = 76/107 (71%) Frame = -3 Query: 455 KELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIYG 276 +EL+ +M KG+ +N QTY IM+DGL GD+ EAC L+EE L+K LC + FDE I G Sbjct: 384 RELVKEMKWKGIVLNLQTYSIMIDGLASKGDIIEACGLLEEALNKGLCTQSSMFDETICG 443 Query: 275 LCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANW 135 LCQRGLV KA +LLK M K+V+PGAR WEALLLSS SK + ++ Sbjct: 444 LCQRGLVRKALELLKQMADKDVSPGARVWEALLLSSVSKLDFVNTSF 490 >ref|XP_007140168.1| hypothetical protein PHAVU_008G089500g [Phaseolus vulgaris] gi|561013301|gb|ESW12162.1| hypothetical protein PHAVU_008G089500g [Phaseolus vulgaris] Length = 514 Score = 107 bits (267), Expect = 3e-21 Identities = 54/109 (49%), Positives = 75/109 (68%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+ +M +M KGV +N +YRIMLDGL G++ EAC L+EEML+K + TFD II+ Sbjct: 382 ARGVMKEMGWKGVGLNLHSYRIMLDGLVGKGEIGEACFLLEEMLEKCFFPRSSTFDHIIF 441 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANWT 132 +CQ+GL+ +A +L K +V K+ PGARAWEALLL S SK +E ++ Sbjct: 442 QMCQKGLIAEAIELTKKIVAKSFVPGARAWEALLLKSGSKLGFSETTFS 490 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis sativus] gi|778683089|ref|XP_011651840.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis sativus] gi|700203575|gb|KGN58708.1| hypothetical protein Csa_3G730720 [Cucumis sativus] Length = 491 Score = 107 bits (266), Expect = 4e-21 Identities = 54/100 (54%), Positives = 72/100 (72%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A++L KM KG+ N +T+RIM+DGLF NG++ EACVL+EEML + TF EI+ Sbjct: 375 ARKLRSKMQLKGLAENLRTFRIMIDGLFHNGEVIEACVLLEEMLGSRFPPQISTFSEILS 434 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSK 159 LC+R +V KA +LL +MVGKN +PG +AWE LLLSS S+ Sbjct: 435 WLCKRHMVGKAVELLALMVGKNFSPGPKAWEILLLSSESE 474 >ref|XP_014496627.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Vigna radiata var. radiata] gi|950955388|ref|XP_014496628.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Vigna radiata var. radiata] Length = 499 Score = 106 bits (265), Expect = 6e-21 Identities = 54/108 (50%), Positives = 74/108 (68%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A+E+M +M KGV +N +YRIMLDGL G++ EAC L+EEML+K L + TFD II+ Sbjct: 385 AREVMKEMGWKGVGLNLHSYRIMLDGLVAKGEIGEACFLLEEMLEKCLFPRSSTFDNIIF 444 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANW 135 +CQ+GL+ +A +L K +V K+ PGAR WEALLL S K +E + Sbjct: 445 QMCQKGLIAEAIELTKKIVAKSFVPGARTWEALLLKSGFKQEFSETTF 492 >ref|XP_012089729.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761267|ref|XP_012089731.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761270|ref|XP_012089732.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761273|ref|XP_012089733.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761276|ref|XP_012089734.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|643706993|gb|KDP22803.1| hypothetical protein JCGZ_00390 [Jatropha curcas] Length = 500 Score = 106 bits (265), Expect = 6e-21 Identities = 56/105 (53%), Positives = 75/105 (71%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A++LM +M KG+ + QTY++M+DG +G + EAC L++E+LDK LC + L FDEII Sbjct: 381 ARDLMKEMGKKGIGPSMQTYKVMIDGSTCSGKIIEACALLDEVLDKGLCAESLIFDEIIC 440 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAE 144 GLCQ G + KA +LL+ M KNVAPG R W+ +LLSSRS N AE Sbjct: 441 GLCQIGSISKALELLEKMALKNVAPGVRVWK-VLLSSRSYINFAE 484 >ref|XP_003623530.2| PPR containing plant-like protein [Medicago truncatula] gi|657378514|gb|AES79748.2| PPR containing plant-like protein [Medicago truncatula] Length = 492 Score = 105 bits (263), Expect = 1e-20 Identities = 53/108 (49%), Positives = 73/108 (67%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 AK +M +M KGV +N TYRIMLDGL G++ EACVL+EEML+K + TFD I++ Sbjct: 379 AKRVMKEMRLKGVELNLHTYRIMLDGLVGKGEIGEACVLLEEMLEKCFYPRSSTFDSIVH 438 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSKFNVAEANW 135 +CQ+GL+ A L+ +V K+ PGA+ WEALLL+S SK +E + Sbjct: 439 QMCQKGLISDALVLMNKIVAKSFDPGAKVWEALLLNSESKVTYSETTF 486 >ref|XP_008442345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083418|ref|XP_008442346.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083420|ref|XP_008442347.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083422|ref|XP_008442348.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] gi|659083424|ref|XP_008442349.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Cucumis melo] Length = 490 Score = 104 bits (260), Expect = 2e-20 Identities = 53/100 (53%), Positives = 71/100 (71%) Frame = -3 Query: 458 AKELMIKMDSKGVRVNSQTYRIMLDGLFQNGDMNEACVLMEEMLDKHLCHKCLTFDEIIY 279 A++L KM KG+ N +T+RIM+DGLF NG++ EAC L+EEML + TF EI+ Sbjct: 374 ARKLRSKMQLKGLAENLRTFRIMIDGLFHNGEVIEACALLEEMLRSRFPPQISTFSEILS 433 Query: 278 GLCQRGLVCKAGDLLKIMVGKNVAPGARAWEALLLSSRSK 159 LC+R +V KA +LL +MVGKN +PG +AWE LLLSS S+ Sbjct: 434 RLCKRHMVGKALELLTLMVGKNFSPGPKAWEILLLSSESE 473