BLASTX nr result
ID: Ziziphus21_contig00025674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025674 (763 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005296082.1| rps16 gene product (chloroplast) [Pentactina... 143 1e-31 ref|YP_009136293.1| ribosomal protein S16 (chloroplast) [Prunus ... 141 6e-31 gb|AHF72021.1| 30S ribosomal protein S16 (chloroplast) [Rosa odo... 140 7e-31 gb|AGN71946.1| ribosomal protein S16 [Dasiphora fruticosa subsp.... 139 2e-30 ref|YP_004021647.1| ribosomal protein S16 [Prunus persica] gi|30... 139 2e-30 ref|YP_762243.1| ribosomal protein S16 [Morus indica] gi|7469482... 139 2e-30 ref|YP_009020020.1| ribosomal protein S16 (plastid) [Prunus mume... 139 3e-30 gb|ADD30041.1| ribosomal protein S16 (chloroplast) [Ficus sp. Mo... 138 5e-30 ref|YP_004286084.1| ribosomal protein S16 [Fragaria vesca subsp.... 138 5e-30 ref|YP_009024663.1| ribosomal protein S16 (chloroplast) [Prunus ... 137 6e-30 ref|YP_009170409.1| ribosomal protein S16 (chloroplast) [Humulus... 137 8e-30 ref|YP_006883245.1| ribosomal protein S16 (chloroplast) [Fragari... 137 8e-30 ref|YP_009175987.1| ribosomal protein S16 (chloroplast) [Ficus r... 136 2e-29 ref|YP_004842221.1| ribosomal protein S16 [Pyrus pyrifolia] gi|3... 135 4e-29 ref|YP_004021299.1| ribosomal protein S16 [Theobroma cacao] gi|8... 135 4e-29 ref|YP_009040189.1| ribosomal protein S16 [Fragaria iinumae] gi|... 134 5e-29 ref|YP_247581.1| ribosomal protein S16 [Cucumis sativus] gi|6751... 134 5e-29 sp|Q2QDA6.1|RR16_CUCSA RecName: Full=30S ribosomal protein S16, ... 134 7e-29 ref|YP_009123055.1| ribosomal protein S16 (chloroplast) [Cannabi... 134 9e-29 ref|YP_538917.1| ribosomal protein S16 [Gossypium hirsutum] gi|3... 133 1e-28 >ref|YP_005296082.1| rps16 gene product (chloroplast) [Pentactina rupicola] gi|371532606|gb|AEX31716.1| ribosomal protein S16 (chloroplast) [Pentactina rupicola] Length = 94 Score = 143 bits (360), Expect = 1e-31 Identities = 75/84 (89%), Positives = 75/84 (89%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDI K Sbjct: 13 QRAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDILK 72 Query: 138 KAGVFTELTLNHQTTVN**KINEI 67 KAGVFTEL LN QT N KINEI Sbjct: 73 KAGVFTELRLNQQTKFN--KINEI 94 >ref|YP_009136293.1| ribosomal protein S16 (chloroplast) [Prunus yedoensis] gi|817527551|ref|YP_009136377.1| ribosomal protein S16 (chloroplast) [Prunus maximowiczii] gi|817527789|ref|YP_009136461.1| ribosomal protein S16 (chloroplast) [Prunus padus] gi|808178171|gb|AKC99503.1| ribosomal protein S16 (chloroplast) [Prunus yedoensis] gi|808178256|gb|AKC99587.1| ribosomal protein S16 (chloroplast) [Prunus maximowiczii] gi|808178341|gb|AKC99671.1| ribosomal protein S16 (chloroplast) [Prunus padus] gi|808178426|gb|AKC99755.1| ribosomal protein S16 (chloroplast) [Prunus serrulata var. spontanea] gi|808178511|gb|AKC99839.1| ribosomal protein S16 (chloroplast) [Prunus subhirtella var. subhirtella] gi|808178596|gb|AKC99923.1| ribosomal protein S16 (chloroplast) [Prunus subhirtella var. subhirtella] Length = 89 Score = 141 bits (355), Expect = 6e-31 Identities = 71/77 (92%), Positives = 71/77 (92%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDISK Sbjct: 13 QRAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVFTEL LN QT N Sbjct: 73 KAGVFTELRLNQQTKFN 89 >gb|AHF72021.1| 30S ribosomal protein S16 (chloroplast) [Rosa odorata var. gigantea] Length = 88 Score = 140 bits (354), Expect = 7e-31 Identities = 70/75 (93%), Positives = 70/75 (93%) Frame = -2 Query: 312 AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISKKA 133 AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDISKKA Sbjct: 14 AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDISKKA 73 Query: 132 GVFTELTLNHQTTVN 88 GVFTEL LN QT N Sbjct: 74 GVFTELRLNQQTKFN 88 >gb|AGN71946.1| ribosomal protein S16 [Dasiphora fruticosa subsp. floribunda] Length = 89 Score = 139 bits (351), Expect = 2e-30 Identities = 70/77 (90%), Positives = 71/77 (92%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVR+RREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDISK Sbjct: 13 QRAIYRIVAIDVRARREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVFTEL LN QT N Sbjct: 73 KAGVFTELHLNQQTKXN 89 >ref|YP_004021647.1| ribosomal protein S16 [Prunus persica] gi|309321416|gb|ADO64957.1| ribosomal protein S16 [Prunus persica] Length = 89 Score = 139 bits (351), Expect = 2e-30 Identities = 70/77 (90%), Positives = 70/77 (90%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDISK Sbjct: 13 QRAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVFTEL N QT N Sbjct: 73 KAGVFTELRFNQQTKFN 89 >ref|YP_762243.1| ribosomal protein S16 [Morus indica] gi|746948284|ref|YP_009110318.1| ribosomal protein S16 (chloroplast) [Morus mongolica] gi|821318538|ref|YP_009139661.1| ribosomal protein S16 (chloroplast) [Morus notabilis] gi|122166823|sp|Q09X35.1|RR16_MORIN RecName: Full=30S ribosomal protein S16, chloroplastic gi|78100299|gb|ABB20940.1| ribosomal protein S16 [Morus indica] gi|723005659|gb|AIX11644.1| ribosomal protein S16 (chloroplast) [Morus mongolica] gi|817162080|gb|AKF34056.1| ribosomal protein S16 (chloroplast) [Morus notabilis] Length = 89 Score = 139 bits (351), Expect = 2e-30 Identities = 70/77 (90%), Positives = 70/77 (90%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGR LRKVGFYDPIKNQTYLNVP ILYFLEKGAQPTGTVHDISK Sbjct: 13 QRAIYRIVAIDVRSRREGRALRKVGFYDPIKNQTYLNVPVILYFLEKGAQPTGTVHDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVF EL LNHQT N Sbjct: 73 KAGVFMELRLNHQTKFN 89 >ref|YP_009020020.1| ribosomal protein S16 (plastid) [Prunus mume] gi|589061035|gb|AHK26856.1| ribosomal protein S16 (plastid) [Prunus mume] Length = 87 Score = 139 bits (349), Expect = 3e-30 Identities = 69/74 (93%), Positives = 69/74 (93%) Frame = -2 Query: 309 IYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISKKAG 130 IYRIVAIDVRSRREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDISKKAG Sbjct: 14 IYRIVAIDVRSRREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDISKKAG 73 Query: 129 VFTELTLNHQTTVN 88 VFTEL LN QT N Sbjct: 74 VFTELHLNQQTKFN 87 >gb|ADD30041.1| ribosomal protein S16 (chloroplast) [Ficus sp. Moore 315] Length = 89 Score = 138 bits (347), Expect = 5e-30 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGR LRKVGFYDPIKNQTYLNVP ILYFLEKGAQPTGTV+DISK Sbjct: 13 QRAIYRIVAIDVRSRREGRALRKVGFYDPIKNQTYLNVPVILYFLEKGAQPTGTVYDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVF EL LNHQT +N Sbjct: 73 KAGVFIELRLNHQTKLN 89 >ref|YP_004286084.1| ribosomal protein S16 [Fragaria vesca subsp. vesca] gi|324022759|gb|ADY15333.1| ribosomal protein S16 [Fragaria vesca subsp. vesca] gi|511265753|gb|AGN71861.1| ribosomal protein S16 [Fragaria vesca subsp. bracteata] Length = 89 Score = 138 bits (347), Expect = 5e-30 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVR+RREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDI K Sbjct: 13 QRAIYRIVAIDVRARREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDILK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVFTEL LN QT +N Sbjct: 73 KAGVFTELHLNQQTKLN 89 >ref|YP_009024663.1| ribosomal protein S16 (chloroplast) [Prunus kansuensis] gi|597569088|gb|AHN13519.1| ribosomal protein S16 (chloroplast) [Prunus kansuensis] Length = 88 Score = 137 bits (346), Expect = 6e-30 Identities = 68/74 (91%), Positives = 68/74 (91%) Frame = -2 Query: 309 IYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISKKAG 130 IYRIVAIDVRSRREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDISKKAG Sbjct: 15 IYRIVAIDVRSRREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDISKKAG 74 Query: 129 VFTELTLNHQTTVN 88 VFTEL N QT N Sbjct: 75 VFTELRFNQQTKFN 88 >ref|YP_009170409.1| ribosomal protein S16 (chloroplast) [Humulus lupulus] gi|927682667|gb|ALE29406.1| ribosomal protein S16 (chloroplast) [Humulus lupulus] Length = 89 Score = 137 bits (345), Expect = 8e-30 Identities = 69/77 (89%), Positives = 69/77 (89%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGR LRKVGFYDPIKNQTYLNVP ILYFLEKGAQPTGTVHDISK Sbjct: 13 QRAIYRIVAIDVRSRREGRALRKVGFYDPIKNQTYLNVPVILYFLEKGAQPTGTVHDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVF EL LNHQ N Sbjct: 73 KAGVFMELRLNHQPKFN 89 >ref|YP_006883245.1| ribosomal protein S16 (chloroplast) [Fragaria vesca subsp. bracteata] gi|428697181|ref|YP_007025365.1| ribosomal protein S16 (chloroplast) [Fragaria chiloensis] gi|428697267|ref|YP_007025450.1| ribosomal protein S16 (chloroplast) [Fragaria virginiana] gi|357198720|gb|AET62636.1| ribosomal protein S16 (chloroplast) [Fragaria chiloensis] gi|357198806|gb|AET62721.1| ribosomal protein S16 (chloroplast) [Fragaria virginiana] gi|378554689|gb|AFC17624.1| ribosomal protein S16 (chloroplast) [Fragaria vesca subsp. bracteata] gi|511265581|gb|AGN71691.1| ribosomal protein S16 [Fragaria vesca subsp. bracteata] gi|511265667|gb|AGN71776.1| ribosomal protein S16 [Fragaria vesca subsp. bracteata] gi|511266011|gb|AGN72116.1| ribosomal protein S16 [Fragaria mandshurica] Length = 89 Score = 137 bits (345), Expect = 8e-30 Identities = 69/77 (89%), Positives = 70/77 (90%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVR+RREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDI K Sbjct: 13 QRAIYRIVAIDVRARREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDILK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVFTEL LN QT N Sbjct: 73 KAGVFTELHLNQQTKFN 89 >ref|YP_009175987.1| ribosomal protein S16 (chloroplast) [Ficus racemosa] gi|937500929|gb|ALI30688.1| ribosomal protein S16 (chloroplast) [Ficus racemosa] Length = 117 Score = 136 bits (342), Expect = 2e-29 Identities = 67/74 (90%), Positives = 69/74 (93%) Frame = -2 Query: 309 IYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISKKAG 130 IYRIVAIDVRSRREGR LRKVGFYDPIKNQTYLNVP ILYFLEKGAQPTGTV+DISKKAG Sbjct: 44 IYRIVAIDVRSRREGRALRKVGFYDPIKNQTYLNVPVILYFLEKGAQPTGTVYDISKKAG 103 Query: 129 VFTELTLNHQTTVN 88 VF EL LNHQT +N Sbjct: 104 VFIELRLNHQTKLN 117 >ref|YP_004842221.1| ribosomal protein S16 [Pyrus pyrifolia] gi|345433543|dbj|BAK69365.1| ribosomal protein S16 [Pyrus pyrifolia] Length = 89 Score = 135 bits (339), Expect = 4e-29 Identities = 68/77 (88%), Positives = 69/77 (89%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTVHDISK Sbjct: 13 QRAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVHDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 +AGVFTEL N Q N Sbjct: 73 RAGVFTELRPNQQIKFN 89 >ref|YP_004021299.1| ribosomal protein S16 [Theobroma cacao] gi|813427770|ref|YP_009132921.1| ribosomal protein S16 (chloroplast) [Hibiscus syriacus] gi|309321249|gb|ADO64792.1| ribosomal protein S16 [Theobroma cacao] gi|328924767|gb|ADO64872.2| ribosomal protein S16 [Theobroma cacao] gi|371925919|gb|AEX57709.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926001|gb|AEX57790.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926083|gb|AEX57871.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926165|gb|AEX57952.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926247|gb|AEX58033.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926329|gb|AEX58114.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926411|gb|AEX58195.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926493|gb|AEX58276.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926575|gb|AEX58357.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|371926657|gb|AEX58438.1| ribosomal protein S16 (chloroplast) [Theobroma grandiflorum] gi|371926739|gb|AEX58519.1| ribosomal protein S16 (chloroplast) [Theobroma cacao] gi|802085252|gb|AKA94846.1| ribosomal protein S16 (chloroplast) [Hibiscus syriacus] Length = 88 Score = 135 bits (339), Expect = 4e-29 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q A+YRIVAIDVRSRREGRDLRKVGFYDPI NQTYLNVPAILYFLEKGAQPTGTVHDI K Sbjct: 13 QRAVYRIVAIDVRSRREGRDLRKVGFYDPINNQTYLNVPAILYFLEKGAQPTGTVHDILK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVFTEL+LN QT N Sbjct: 73 KAGVFTELSLN-QTKFN 88 >ref|YP_009040189.1| ribosomal protein S16 [Fragaria iinumae] gi|511265925|gb|AGN72031.1| ribosomal protein S16 [Fragaria iinumae] Length = 89 Score = 134 bits (338), Expect = 5e-29 Identities = 68/77 (88%), Positives = 70/77 (90%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVR+RREGRDLRKVGFYDPIKNQ YLNVPAILYFLEKGAQPTGTV+DI K Sbjct: 13 QRAIYRIVAIDVRARREGRDLRKVGFYDPIKNQIYLNVPAILYFLEKGAQPTGTVNDILK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVFTEL LN QT N Sbjct: 73 KAGVFTELHLNQQTKFN 89 >ref|YP_247581.1| ribosomal protein S16 [Cucumis sativus] gi|67511380|emb|CAJ00740.1| ribosomal protein S16 [Cucumis sativus] gi|115432787|gb|ABI97400.1| ribosomal protein S16 [Cucumis sativus] gi|595645233|gb|AHM88696.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645293|gb|AHM88755.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645352|gb|AHM88813.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645410|gb|AHM88870.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645469|gb|AHM88928.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645528|gb|AHM88986.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645588|gb|AHM89045.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645648|gb|AHM89104.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645708|gb|AHM89163.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645768|gb|AHM89222.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645828|gb|AHM89281.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645889|gb|AHM89341.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595645949|gb|AHM89400.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646009|gb|AHM89459.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646069|gb|AHM89518.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646130|gb|AHM89578.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646190|gb|AHM89637.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646250|gb|AHM89696.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646310|gb|AHM89755.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646370|gb|AHM89814.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646430|gb|AHM89873.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646490|gb|AHM89932.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646550|gb|AHM89991.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646610|gb|AHM90050.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646670|gb|AHM90109.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646730|gb|AHM90168.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646790|gb|AHM90227.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646850|gb|AHM90286.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646910|gb|AHM90345.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595646970|gb|AHM90404.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647030|gb|AHM90463.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647090|gb|AHM90522.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647150|gb|AHM90581.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647210|gb|AHM90640.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647270|gb|AHM90699.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647330|gb|AHM90758.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647390|gb|AHM90817.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647450|gb|AHM90876.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647510|gb|AHM90935.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647570|gb|AHM90994.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647630|gb|AHM91053.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] gi|595647867|gb|AHM91286.1| ribosomal protein S16 (chloroplast) [Lagenaria siceraria] Length = 84 Score = 134 bits (338), Expect = 5e-29 Identities = 66/71 (92%), Positives = 68/71 (95%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q A+YRI+AIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDI K Sbjct: 13 QRAVYRIIAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDILK 72 Query: 138 KAGVFTELTLN 106 KAGVFTEL LN Sbjct: 73 KAGVFTELHLN 83 >sp|Q2QDA6.1|RR16_CUCSA RecName: Full=30S ribosomal protein S16, chloroplastic gi|74027084|gb|AAZ94634.1| ribosomal protein S16 [Cucumis sativus] Length = 85 Score = 134 bits (337), Expect = 7e-29 Identities = 65/69 (94%), Positives = 67/69 (97%) Frame = -2 Query: 312 AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISKKA 133 A+YRI+AIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDI KKA Sbjct: 16 AVYRIIAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDILKKA 75 Query: 132 GVFTELTLN 106 GVFTEL LN Sbjct: 76 GVFTELHLN 84 >ref|YP_009123055.1| ribosomal protein S16 (chloroplast) [Cannabis sativa] gi|756142194|gb|AJK91404.1| ribosomal protein S16 (chloroplast) [Cannabis sativa] gi|915477547|gb|AKX33530.1| ribosomal protein S16 (chloroplast) [Cannabis sativa] Length = 89 Score = 134 bits (336), Expect = 9e-29 Identities = 68/77 (88%), Positives = 68/77 (88%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q AIYRIVAIDVRSRREGR LRKVGFYDPIKNQTYLNVP IL FLEKGAQPTGTVHDISK Sbjct: 13 QRAIYRIVAIDVRSRREGRALRKVGFYDPIKNQTYLNVPVILSFLEKGAQPTGTVHDISK 72 Query: 138 KAGVFTELTLNHQTTVN 88 KAGVF EL LNHQ N Sbjct: 73 KAGVFMELRLNHQPKFN 89 >ref|YP_538917.1| ribosomal protein S16 [Gossypium hirsutum] gi|325210912|ref|YP_004285986.1| ribosomal protein S16 [Gossypium thurberi] gi|372291015|ref|YP_005087771.1| ribosomal protein S16 (chloroplast) [Gossypium darwinii] gi|372291368|ref|YP_005088262.1| ribosomal protein S16 (chloroplast) [Gossypium tomentosum] gi|372291466|ref|YP_005088358.1| ribosomal protein S16 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291756|ref|YP_005088898.1| ribosomal protein S16 (chloroplast) [Gossypium mustelinum] gi|372291840|ref|YP_005088981.1| ribosomal protein S16 (chloroplast) [Gossypium arboreum] gi|570759645|ref|YP_008992705.1| ribosomal protein S16 (chloroplast) [Gossypium longicalyx] gi|122245017|sp|Q2L8Y7.1|RR16_GOSHI RecName: Full=30S ribosomal protein S16, chloroplastic gi|85687398|gb|ABC73610.1| ribosomal protein S16 (chloroplast) [Gossypium hirsutum] gi|290775774|gb|ADD62270.1| ribosomal protein S16 [Gossypium thurberi] gi|318084299|gb|ADV38775.1| ribosomal protein S16 (chloroplast) [Gossypium arboreum] gi|318084383|gb|ADV38858.1| ribosomal protein S16 (chloroplast) [Gossypium darwinii] gi|318084467|gb|ADV38941.1| ribosomal protein S16 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084551|gb|ADV39024.1| ribosomal protein S16 (chloroplast) [Gossypium mustelinum] gi|318084719|gb|ADV39190.1| ribosomal protein S16 (chloroplast) [Gossypium tomentosum] gi|326457284|gb|ADZ74545.1| ribosomal protein S16 [Gossypium longicalyx] gi|329317139|gb|AEB90497.1| ribosomal protein S16 (chloroplast) [Gossypium hirsutum] gi|329317223|gb|AEB90580.1| ribosomal protein S16 (chloroplast) [Gossypium hirsutum] gi|329317307|gb|AEB90663.1| ribosomal protein S16 (chloroplast) [Gossypium barbadense] gi|329317391|gb|AEB90746.1| ribosomal protein S16 (chloroplast) [Gossypium barbadense] gi|329317475|gb|AEB90829.1| ribosomal protein S16 (chloroplast) [Gossypium barbadense] Length = 88 Score = 133 bits (335), Expect = 1e-28 Identities = 66/71 (92%), Positives = 67/71 (94%) Frame = -2 Query: 318 Q*AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISK 139 Q A+YRIVAIDVRSRREGRDLRKVGFYDPI NQTYLNVPAILYFLEKGAQPT TVHDI K Sbjct: 13 QRAVYRIVAIDVRSRREGRDLRKVGFYDPINNQTYLNVPAILYFLEKGAQPTATVHDILK 72 Query: 138 KAGVFTELTLN 106 KAGVFTELTLN Sbjct: 73 KAGVFTELTLN 83