BLASTX nr result
ID: Ziziphus21_contig00025655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025655 (224 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009361764.1| PREDICTED: pentatricopeptide repeat-containi... 129 6e-28 ref|XP_009371377.1| PREDICTED: pentatricopeptide repeat-containi... 126 7e-27 ref|XP_008383030.1| PREDICTED: pentatricopeptide repeat-containi... 126 7e-27 ref|XP_008226294.1| PREDICTED: pentatricopeptide repeat-containi... 126 7e-27 ref|XP_007213918.1| hypothetical protein PRUPE_ppa004201mg [Prun... 126 7e-27 ref|XP_012441071.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_008364411.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 123 5e-26 ref|XP_008356327.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_007022279.1| Pentatricopeptide repeat (PPR) superfamily p... 122 8e-26 ref|XP_011460866.1| PREDICTED: pentatricopeptide repeat-containi... 122 8e-26 ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_006585428.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containi... 120 5e-25 ref|XP_011014088.1| PREDICTED: pentatricopeptide repeat-containi... 119 7e-25 ref|XP_011030727.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 gb|KDO53403.1| hypothetical protein CISIN_1g041458mg [Citrus sin... 119 1e-24 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 119 1e-24 ref|XP_006478018.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_006441032.1| hypothetical protein CICLE_v10019503mg [Citr... 119 1e-24 >ref|XP_009361764.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Pyrus x bretschneideri] Length = 567 Score = 129 bits (325), Expect = 6e-28 Identities = 65/74 (87%), Positives = 69/74 (93%) Frame = -2 Query: 223 FERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCK 44 FE MV KGQKPDVAQATQLLYDLCKVNK +KAVRV+EMMV S IIPDAASYTFLVNYLCK Sbjct: 85 FESMVGKGQKPDVAQATQLLYDLCKVNKMRKAVRVIEMMVLSGIIPDAASYTFLVNYLCK 144 Query: 43 RGSIGYAMQLVDKM 2 RG+IGYAMQLV+KM Sbjct: 145 RGNIGYAMQLVEKM 158 >ref|XP_009371377.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Pyrus x bretschneideri] Length = 567 Score = 126 bits (316), Expect = 7e-27 Identities = 63/73 (86%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV KGQKPDVAQATQLLYDLCK NK +KAVRV+EMMV S IIPDAASYTFLVNYLCKR Sbjct: 86 ESMVGKGQKPDVAQATQLLYDLCKANKMRKAVRVIEMMVVSGIIPDAASYTFLVNYLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >ref|XP_008383030.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Malus domestica] gi|657981998|ref|XP_008383031.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Malus domestica] Length = 567 Score = 126 bits (316), Expect = 7e-27 Identities = 63/73 (86%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV KGQKPDVAQATQLLYDLCK NK +KAVRV+EMMV S IIPDAASYTFLVNYLCKR Sbjct: 86 ESMVGKGQKPDVAQATQLLYDLCKANKMRKAVRVIEMMVVSGIIPDAASYTFLVNYLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >ref|XP_008226294.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Prunus mume] Length = 567 Score = 126 bits (316), Expect = 7e-27 Identities = 62/73 (84%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV KGQKPDVAQATQLLYDLCK NK +KAVRV+EMMV + IIPDAASYTFLVNYLCKR Sbjct: 86 ESMVGKGQKPDVAQATQLLYDLCKANKMRKAVRVIEMMVSAGIIPDAASYTFLVNYLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >ref|XP_007213918.1| hypothetical protein PRUPE_ppa004201mg [Prunus persica] gi|462409783|gb|EMJ15117.1| hypothetical protein PRUPE_ppa004201mg [Prunus persica] Length = 523 Score = 126 bits (316), Expect = 7e-27 Identities = 62/73 (84%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV KGQKPDVAQATQLLYDLCK NK +KAVRV+EMMV + IIPDAASYTFLVNYLCKR Sbjct: 86 ESMVGKGQKPDVAQATQLLYDLCKANKMRKAVRVIEMMVSAGIIPDAASYTFLVNYLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >ref|XP_012441071.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Gossypium raimondii] gi|763794400|gb|KJB61396.1| hypothetical protein B456_009G354800 [Gossypium raimondii] Length = 568 Score = 123 bits (309), Expect = 5e-26 Identities = 60/73 (82%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV KGQKPDV QATQLLYDLCKVNK KK++RVMEMMV S IIPDAASYTFLVN+LCKR Sbjct: 86 EYMVGKGQKPDVVQATQLLYDLCKVNKMKKSIRVMEMMVDSGIIPDAASYTFLVNHLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G++G+AMQLV+KM Sbjct: 146 GNVGHAMQLVEKM 158 >ref|XP_008364411.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like, partial [Malus domestica] Length = 561 Score = 123 bits (309), Expect = 5e-26 Identities = 62/73 (84%), Positives = 66/73 (90%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV K QKPDVAQATQLLYDLCK NK +KAVRV+EMMV S IIPDAASYTFLVNYLCKR Sbjct: 86 ESMVGKDQKPDVAQATQLLYDLCKANKMRKAVRVIEMMVVSGIIPDAASYTFLVNYLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >ref|XP_008356327.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Malus domestica] Length = 207 Score = 123 bits (309), Expect = 5e-26 Identities = 62/73 (84%), Positives = 66/73 (90%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV K QKPDVAQATQLLYDLCK NK +KAVRV+EMMV S IIPDAASYTFLVNYLCKR Sbjct: 86 ESMVGKDQKPDVAQATQLLYDLCKANKMRKAVRVIEMMVVSGIIPDAASYTFLVNYLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >ref|XP_007022279.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508721907|gb|EOY13804.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 568 Score = 122 bits (307), Expect = 8e-26 Identities = 59/73 (80%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV KGQKPDVAQATQLLYDLCK NK KK++RV+EMMV S IIPDAASYTFLVN+LCKR Sbjct: 86 EYMVGKGQKPDVAQATQLLYDLCKANKMKKSIRVLEMMVNSGIIPDAASYTFLVNHLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G++G+AMQLV+KM Sbjct: 146 GNVGHAMQLVEKM 158 >ref|XP_011460866.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Fragaria vesca subsp. vesca] Length = 566 Score = 122 bits (307), Expect = 8e-26 Identities = 60/73 (82%), Positives = 65/73 (89%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E M KGQKPDV QATQLLYDLCK +K +KA+RVMEMMV S IIPDAASYTFLVNYLCKR Sbjct: 85 ESMTGKGQKPDVGQATQLLYDLCKASKMRKAMRVMEMMVASGIIPDAASYTFLVNYLCKR 144 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 145 GNIGYAMQLVEKM 157 >ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Glycine max] gi|947064400|gb|KRH13661.1| hypothetical protein GLYMA_15G254900 [Glycine max] Length = 571 Score = 121 bits (303), Expect = 2e-25 Identities = 59/73 (80%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E +V KGQKP+V QATQLLYDLCK NKA+KAVRVMEMMVGS IIPDAASYT LVN+LCKR Sbjct: 88 EYLVGKGQKPEVNQATQLLYDLCKFNKARKAVRVMEMMVGSGIIPDAASYTHLVNFLCKR 147 Query: 40 GSIGYAMQLVDKM 2 G++GYA+QLV+KM Sbjct: 148 GNVGYAIQLVEKM 160 >ref|XP_006585428.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like isoform X2 [Glycine max] gi|947095210|gb|KRH43795.1| hypothetical protein GLYMA_08G172400 [Glycine max] Length = 405 Score = 121 bits (303), Expect = 2e-25 Identities = 59/73 (80%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E +V KGQKP+V QATQLLYDLCK NKA+KAVRVMEMMVGS IIPDAASYT LVN+LCKR Sbjct: 88 EYLVGKGQKPEVNQATQLLYDLCKFNKARKAVRVMEMMVGSGIIPDAASYTHLVNFLCKR 147 Query: 40 GSIGYAMQLVDKM 2 G++GYA+QLV+KM Sbjct: 148 GNVGYAIQLVEKM 160 >ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like isoform X1 [Glycine max] gi|734390524|gb|KHN26812.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] gi|947095209|gb|KRH43794.1| hypothetical protein GLYMA_08G172400 [Glycine max] Length = 572 Score = 121 bits (303), Expect = 2e-25 Identities = 59/73 (80%), Positives = 67/73 (91%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E +V KGQKP+V QATQLLYDLCK NKA+KAVRVMEMMVGS IIPDAASYT LVN+LCKR Sbjct: 88 EYLVGKGQKPEVNQATQLLYDLCKFNKARKAVRVMEMMVGSGIIPDAASYTHLVNFLCKR 147 Query: 40 GSIGYAMQLVDKM 2 G++GYA+QLV+KM Sbjct: 148 GNVGYAIQLVEKM 160 >ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Cicer arietinum] Length = 572 Score = 120 bits (300), Expect = 5e-25 Identities = 59/73 (80%), Positives = 64/73 (87%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E MV KG KPDV QATQLLYDLCK KA+KAVRVME+M GS IIPD ASYTFLVNYLCKR Sbjct: 91 EYMVGKGHKPDVVQATQLLYDLCKSGKARKAVRVMEIMGGSGIIPDVASYTFLVNYLCKR 150 Query: 40 GSIGYAMQLVDKM 2 G++GYAMQLV+KM Sbjct: 151 GNVGYAMQLVEKM 163 >ref|XP_011014088.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Populus euphratica] Length = 567 Score = 119 bits (299), Expect = 7e-25 Identities = 60/73 (82%), Positives = 64/73 (87%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E +V KG KPDVAQATQLLYDLCK NK KKA RVMEMM+ S IIPDAASYTFLVN LCKR Sbjct: 86 EFIVRKGHKPDVAQATQLLYDLCKSNKMKKATRVMEMMIESGIIPDAASYTFLVNNLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >ref|XP_011030727.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Populus euphratica] Length = 567 Score = 119 bits (297), Expect = 1e-24 Identities = 60/73 (82%), Positives = 64/73 (87%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E +V KG KPDVAQATQLLYDLCK NK KKA RVMEMM+ S IIPDAASYTFLVN LCKR Sbjct: 86 EFIVGKGHKPDVAQATQLLYDLCKSNKMKKATRVMEMMIESGIIPDAASYTFLVNNLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G+IGYAMQLV+KM Sbjct: 146 GNIGYAMQLVEKM 158 >gb|KDO53403.1| hypothetical protein CISIN_1g041458mg [Citrus sinensis] Length = 568 Score = 119 bits (297), Expect = 1e-24 Identities = 56/73 (76%), Positives = 64/73 (87%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 ERMV KG KPDV QAT LLYDLCK NK KKA++VMEMMV S IIPDA+SYT+LVN LCK+ Sbjct: 87 ERMVSKGHKPDVVQATNLLYDLCKANKMKKAIKVMEMMVSSGIIPDASSYTYLVNCLCKK 146 Query: 40 GSIGYAMQLVDKM 2 G++GYAMQLV+KM Sbjct: 147 GNVGYAMQLVEKM 159 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 119 bits (297), Expect = 1e-24 Identities = 56/73 (76%), Positives = 64/73 (87%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 E +V+ G KPDV QATQLLYDLCK NK KKA+RVMEMM+ IIPDAASYTFLVN+LCKR Sbjct: 86 EHIVKNGHKPDVVQATQLLYDLCKSNKMKKAIRVMEMMISCGIIPDAASYTFLVNHLCKR 145 Query: 40 GSIGYAMQLVDKM 2 G++GYAMQLV+KM Sbjct: 146 GNVGYAMQLVEKM 158 >ref|XP_006478018.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Citrus sinensis] Length = 568 Score = 119 bits (297), Expect = 1e-24 Identities = 56/73 (76%), Positives = 64/73 (87%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 ERMV KG KPDV QAT LLYDLCK NK KKA++VMEMMV S IIPDA+SYT+LVN LCK+ Sbjct: 87 ERMVSKGHKPDVVQATNLLYDLCKANKMKKAIKVMEMMVSSGIIPDASSYTYLVNCLCKK 146 Query: 40 GSIGYAMQLVDKM 2 G++GYAMQLV+KM Sbjct: 147 GNVGYAMQLVEKM 159 >ref|XP_006441032.1| hypothetical protein CICLE_v10019503mg [Citrus clementina] gi|557543294|gb|ESR54272.1| hypothetical protein CICLE_v10019503mg [Citrus clementina] Length = 568 Score = 119 bits (297), Expect = 1e-24 Identities = 56/73 (76%), Positives = 64/73 (87%) Frame = -2 Query: 220 ERMVEKGQKPDVAQATQLLYDLCKVNKAKKAVRVMEMMVGSCIIPDAASYTFLVNYLCKR 41 ERMV KG KPDV QAT LLYDLCK NK KKA++VMEMMV S IIPDA+SYT+LVN LCK+ Sbjct: 87 ERMVSKGHKPDVVQATNLLYDLCKANKMKKAIKVMEMMVSSGIIPDASSYTYLVNCLCKK 146 Query: 40 GSIGYAMQLVDKM 2 G++GYAMQLV+KM Sbjct: 147 GNVGYAMQLVEKM 159