BLASTX nr result
ID: Ziziphus21_contig00025358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025358 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67244.1| hypothetical protein M569_07533, partial [Genlise... 56 9e-06 >gb|EPS67244.1| hypothetical protein M569_07533, partial [Genlisea aurea] Length = 139 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 FVGNLPYDVDSEKLAQFFNQAGIVEIAEVK 91 FVGNLPYDVDSEKLAQ F +AG+VEIAEVK Sbjct: 103 FVGNLPYDVDSEKLAQIFERAGVVEIAEVK 132