BLASTX nr result
ID: Ziziphus21_contig00023785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00023785 (242 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209983.1| hypothetical protein PRUPE_ppa005133mg [Prun... 68 2e-09 ref|XP_008240061.1| PREDICTED: uncharacterized protein LOC103338... 65 3e-08 ref|XP_010087330.1| E3 ubiquitin-protein ligase RING1 [Morus not... 59 1e-06 >ref|XP_007209983.1| hypothetical protein PRUPE_ppa005133mg [Prunus persica] gi|462405718|gb|EMJ11182.1| hypothetical protein PRUPE_ppa005133mg [Prunus persica] Length = 475 Score = 68.2 bits (165), Expect = 2e-09 Identities = 37/64 (57%), Positives = 46/64 (71%), Gaps = 4/64 (6%) Frame = +2 Query: 59 SMAEVTYLHLHEVEDDTHHPDPALSLDSIP---YYDFDLYSSYPEFPPSDPSLHAH-STF 226 SMAEVT+LHLH+ +D+ H L+LD +P ++DFDLYSS EFPPSD SL AH T Sbjct: 2 SMAEVTFLHLHDPDDEPHQ---TLTLDPLPNWAHHDFDLYSSDLEFPPSDRSLRAHILTV 58 Query: 227 HEDD 238 HED+ Sbjct: 59 HEDE 62 >ref|XP_008240061.1| PREDICTED: uncharacterized protein LOC103338621 [Prunus mume] Length = 373 Score = 64.7 bits (156), Expect = 3e-08 Identities = 35/63 (55%), Positives = 46/63 (73%), Gaps = 4/63 (6%) Frame = +2 Query: 62 MAEVTYLHLHEVEDDTHHPDPALSLDSIP---YYDFDLYSSYPEFPPSDPSLHAH-STFH 229 MAEVT+LHLH+ +D+ P +L+LD +P ++DFD+YSS EFPPSD SL AH T H Sbjct: 1 MAEVTFLHLHDPDDE---PRQSLTLDPLPNWAHHDFDVYSSDLEFPPSDRSLRAHILTVH 57 Query: 230 EDD 238 ED+ Sbjct: 58 EDE 60 >ref|XP_010087330.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis] gi|587838191|gb|EXB28904.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis] Length = 449 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/63 (55%), Positives = 44/63 (69%), Gaps = 5/63 (7%) Frame = +2 Query: 62 MAEVTYLHLHEVEDDTHHPDPALSLD-SIPYY---DFDLYSSYPEFPPSDPSLHAH-STF 226 MAEVT+L LH++EDD H L+LD S+PY+ DFDLY+S EFPPSD +LH+ S Sbjct: 1 MAEVTFLCLHDLEDDPHQ---TLALDHSVPYWSHSDFDLYASDLEFPPSDLNLHSQISAV 57 Query: 227 HED 235 H D Sbjct: 58 HGD 60