BLASTX nr result
ID: Ziziphus21_contig00023749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00023749 (351 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088193.1| hypothetical protein L484_005539 [Morus nota... 60 5e-07 ref|XP_008452410.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|XP_008452409.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|XP_008452408.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|XP_008452406.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >ref|XP_010088193.1| hypothetical protein L484_005539 [Morus notabilis] gi|587841736|gb|EXB32333.1| hypothetical protein L484_005539 [Morus notabilis] Length = 548 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 112 MVSETLQFFAQLRRASKFPSPFTFSRLLHSLVDSNCG 2 MV ETLQFFA LRR S+FP+PFTF++LLH L +NCG Sbjct: 1 MVRETLQFFAHLRRTSRFPTPFTFNKLLHHLTSANCG 37 >ref|XP_008452410.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 isoform X4 [Cucumis melo] Length = 541 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 112 MVSETLQFFAQLRRASKFPSPFTFSRLLHSLVDSNCG 2 MV E LQF A LRR S+FPSPFT ++LLHSL++S CG Sbjct: 1 MVKEALQFLAHLRRISRFPSPFTCNKLLHSLINSGCG 37 >ref|XP_008452409.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 isoform X3 [Cucumis melo] Length = 578 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 112 MVSETLQFFAQLRRASKFPSPFTFSRLLHSLVDSNCG 2 MV E LQF A LRR S+FPSPFT ++LLHSL++S CG Sbjct: 1 MVKEALQFLAHLRRISRFPSPFTCNKLLHSLINSGCG 37 >ref|XP_008452408.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 isoform X2 [Cucumis melo] Length = 611 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 112 MVSETLQFFAQLRRASKFPSPFTFSRLLHSLVDSNCG 2 MV E LQF A LRR S+FPSPFT ++LLHSL++S CG Sbjct: 1 MVKEALQFLAHLRRISRFPSPFTCNKLLHSLINSGCG 37 >ref|XP_008452406.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 isoform X1 [Cucumis melo] Length = 611 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 112 MVSETLQFFAQLRRASKFPSPFTFSRLLHSLVDSNCG 2 MV E LQF A LRR S+FPSPFT ++LLHSL++S CG Sbjct: 1 MVKEALQFLAHLRRISRFPSPFTCNKLLHSLINSGCG 37