BLASTX nr result
ID: Ziziphus21_contig00023723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00023723 (601 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68669.1| hypothetical protein VITISV_039388 [Vitis vinifera] 61 4e-07 >emb|CAN68669.1| hypothetical protein VITISV_039388 [Vitis vinifera] Length = 1360 Score = 61.2 bits (147), Expect = 4e-07 Identities = 30/65 (46%), Positives = 44/65 (67%) Frame = +2 Query: 251 MNTCGKTDTEFQSEVLAILARHETKFERINATLQMILTDLQDLRIHLVQQPVEHDLNSFH 430 M+T GKT+ EF+++V ILARHE+ F+++NA LQ +LT+LQ LR Q + N F Sbjct: 1 MDTRGKTNAEFRNDVNEILARHESSFDQVNAALQAVLTELQTLRASRSQNTSPSETNPFA 60 Query: 431 KGDSS 445 + +SS Sbjct: 61 RDESS 65