BLASTX nr result
ID: Ziziphus21_contig00023658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00023658 (546 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO79467.1| hypothetical protein CISIN_1g030126mg [Citrus sin... 57 1e-07 ref|XP_011048864.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-li... 60 5e-07 ref|XP_002313810.1| hypothetical protein POPTR_0009s11590g [Popu... 60 5e-07 ref|XP_010096212.1| NEDD8-conjugating enzyme Ubc12 [Morus notabi... 59 1e-06 ref|XP_006363136.1| PREDICTED: probable NEDD8-conjugating enzyme... 59 1e-06 ref|XP_004232378.1| PREDICTED: probable NEDD8-conjugating enzyme... 59 2e-06 gb|KNA21581.1| hypothetical protein SOVF_041850 [Spinacia oleracea] 58 3e-06 ref|XP_010690925.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [B... 58 3e-06 gb|KRH76869.1| hypothetical protein GLYMA_01G178200 [Glycine max] 57 4e-06 gb|KRH76868.1| hypothetical protein GLYMA_01G178200 [Glycine max] 57 4e-06 ref|XP_010095291.1| NEDD8-conjugating enzyme Ubc12 [Morus notabi... 57 4e-06 ref|XP_009774644.1| PREDICTED: probable NEDD8-conjugating enzyme... 57 4e-06 ref|XP_009618791.1| PREDICTED: probable NEDD8-conjugating enzyme... 57 4e-06 ref|XP_012079083.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [J... 57 4e-06 ref|XP_002525098.1| ubiquitin-conjugating enzyme m, putative [Ri... 57 4e-06 ref|XP_007156897.1| hypothetical protein PHAVU_002G026500g [Phas... 57 4e-06 ref|XP_007042730.1| RUB1 conjugating enzyme 1 isoform 1 [Theobro... 57 4e-06 ref|NP_001242389.1| uncharacterized protein LOC100813186 [Glycin... 57 4e-06 ref|XP_002310200.1| RUB1 CONJUGATING ENZYME 1 family protein [Po... 57 4e-06 ref|XP_012489145.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [G... 57 5e-06 >gb|KDO79467.1| hypothetical protein CISIN_1g030126mg [Citrus sinensis] Length = 182 Score = 56.6 bits (135), Expect(2) = 1e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKVTV 107 Y + GTF+FSF+VP IYPH+APKVKCKTKV + Sbjct: 71 YYQNGTFVFSFEVPPIYPHDAPKVKCKTKVDI 102 Score = 25.8 bits (55), Expect(2) = 1e-07 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 38 FLANLQVYHPNI 3 F +NLQVYHPNI Sbjct: 125 FESNLQVYHPNI 136 >ref|XP_011048864.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Populus euphratica] Length = 183 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y RGGTF+FSFQ+ SIYPHEAPKVKCKTKV Sbjct: 71 YYRGGTFVFSFQISSIYPHEAPKVKCKTKV 100 >ref|XP_002313810.1| hypothetical protein POPTR_0009s11590g [Populus trichocarpa] gi|222850218|gb|EEE87765.1| hypothetical protein POPTR_0009s11590g [Populus trichocarpa] Length = 183 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y RGGTF+FSFQ+ SIYPHEAPKVKCKTKV Sbjct: 71 YYRGGTFVFSFQISSIYPHEAPKVKCKTKV 100 >ref|XP_010096212.1| NEDD8-conjugating enzyme Ubc12 [Morus notabilis] gi|587874469|gb|EXB63607.1| NEDD8-conjugating enzyme Ubc12 [Morus notabilis] Length = 184 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GG+FL+SFQVPS+YPHEAPKVKCKTKV Sbjct: 71 YYVGGSFLYSFQVPSVYPHEAPKVKCKTKV 100 >ref|XP_006363136.1| PREDICTED: probable NEDD8-conjugating enzyme Ubc12-like [Solanum tuberosum] Length = 183 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GG FLFSFQVPSIYPHE PKVKCKTKV Sbjct: 71 YYAGGNFLFSFQVPSIYPHEPPKVKCKTKV 100 >ref|XP_004232378.1| PREDICTED: probable NEDD8-conjugating enzyme Ubc12-like [Solanum lycopersicum] Length = 183 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GG FLFSFQVPSIYPHE PKVKCKTKV Sbjct: 71 YYAGGKFLFSFQVPSIYPHEPPKVKCKTKV 100 >gb|KNA21581.1| hypothetical protein SOVF_041850 [Spinacia oleracea] Length = 184 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTF+F+FQVPS+YPHE PKVKCKTKV Sbjct: 71 YYLGGTFVFTFQVPSVYPHEPPKVKCKTKV 100 >ref|XP_010690925.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Beta vulgaris subsp. vulgaris] gi|870848189|gb|KMT00478.1| hypothetical protein BVRB_9g217790 [Beta vulgaris subsp. vulgaris] Length = 184 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTF+F+FQVPS+YPHE PKVKCKTKV Sbjct: 71 YYLGGTFVFTFQVPSVYPHEPPKVKCKTKV 100 >gb|KRH76869.1| hypothetical protein GLYMA_01G178200 [Glycine max] Length = 146 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >gb|KRH76868.1| hypothetical protein GLYMA_01G178200 [Glycine max] Length = 135 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 23 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 52 >ref|XP_010095291.1| NEDD8-conjugating enzyme Ubc12 [Morus notabilis] gi|587869835|gb|EXB59137.1| NEDD8-conjugating enzyme Ubc12 [Morus notabilis] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >ref|XP_009774644.1| PREDICTED: probable NEDD8-conjugating enzyme Ubc12-like [Nicotiana sylvestris] gi|698570591|ref|XP_009774645.1| PREDICTED: probable NEDD8-conjugating enzyme Ubc12-like [Nicotiana sylvestris] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GG FLFSF+VPSIYPHE PKVKCKTKV Sbjct: 71 YYAGGKFLFSFEVPSIYPHEPPKVKCKTKV 100 >ref|XP_009618791.1| PREDICTED: probable NEDD8-conjugating enzyme Ubc12-like [Nicotiana tomentosiformis] gi|697129461|ref|XP_009618792.1| PREDICTED: probable NEDD8-conjugating enzyme Ubc12-like [Nicotiana tomentosiformis] gi|697129463|ref|XP_009618793.1| PREDICTED: probable NEDD8-conjugating enzyme Ubc12-like [Nicotiana tomentosiformis] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GG FLFSF+VPSIYPHE PKVKCKTKV Sbjct: 71 YYAGGKFLFSFEVPSIYPHEPPKVKCKTKV 100 >ref|XP_012079083.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Jatropha curcas] gi|802640932|ref|XP_012079084.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Jatropha curcas] gi|802640934|ref|XP_012079085.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Jatropha curcas] gi|802640936|ref|XP_012079086.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Jatropha curcas] gi|802640938|ref|XP_012079087.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Jatropha curcas] gi|643721927|gb|KDP31806.1| hypothetical protein JCGZ_12267 [Jatropha curcas] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >ref|XP_002525098.1| ubiquitin-conjugating enzyme m, putative [Ricinus communis] gi|223535557|gb|EEF37225.1| ubiquitin-conjugating enzyme m, putative [Ricinus communis] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >ref|XP_007156897.1| hypothetical protein PHAVU_002G026500g [Phaseolus vulgaris] gi|561030312|gb|ESW28891.1| hypothetical protein PHAVU_002G026500g [Phaseolus vulgaris] Length = 170 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >ref|XP_007042730.1| RUB1 conjugating enzyme 1 isoform 1 [Theobroma cacao] gi|590687675|ref|XP_007042731.1| RUB1 conjugating enzyme 1 isoform 1 [Theobroma cacao] gi|508706665|gb|EOX98561.1| RUB1 conjugating enzyme 1 isoform 1 [Theobroma cacao] gi|508706666|gb|EOX98562.1| RUB1 conjugating enzyme 1 isoform 1 [Theobroma cacao] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >ref|NP_001242389.1| uncharacterized protein LOC100813186 [Glycine max] gi|571487527|ref|XP_006590677.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Glycine max] gi|255625655|gb|ACU13172.1| unknown [Glycine max] gi|255642299|gb|ACU21414.1| unknown [Glycine max] gi|734411763|gb|KHN36149.1| NEDD8-conjugating enzyme Ubc12 [Glycine soja] gi|734423092|gb|KHN42013.1| NEDD8-conjugating enzyme Ubc12 [Glycine soja] gi|947079821|gb|KRH28610.1| hypothetical protein GLYMA_11G064000 [Glycine max] gi|947079822|gb|KRH28611.1| hypothetical protein GLYMA_11G064000 [Glycine max] gi|947079823|gb|KRH28612.1| hypothetical protein GLYMA_11G064000 [Glycine max] gi|947129013|gb|KRH76867.1| hypothetical protein GLYMA_01G178200 [Glycine max] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >ref|XP_002310200.1| RUB1 CONJUGATING ENZYME 1 family protein [Populus trichocarpa] gi|743838446|ref|XP_011025714.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Populus euphratica] gi|743838450|ref|XP_011025715.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Populus euphratica] gi|118483300|gb|ABK93552.1| unknown [Populus trichocarpa] gi|222853103|gb|EEE90650.1| RUB1 CONJUGATING ENZYME 1 family protein [Populus trichocarpa] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYLGGTFLFSFQVSPIYPHEAPKVKCKTKV 100 >ref|XP_012489145.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Gossypium raimondii] gi|823184281|ref|XP_012489146.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Gossypium raimondii] gi|763773086|gb|KJB40209.1| hypothetical protein B456_007G051200 [Gossypium raimondii] gi|763773087|gb|KJB40210.1| hypothetical protein B456_007G051200 [Gossypium raimondii] gi|763773088|gb|KJB40211.1| hypothetical protein B456_007G051200 [Gossypium raimondii] Length = 183 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 202 YNRGGTFLFSFQVPSIYPHEAPKVKCKTKV 113 Y GGTFLFSFQV IYPHEAPKVKCKTKV Sbjct: 71 YYFGGTFLFSFQVSPIYPHEAPKVKCKTKV 100