BLASTX nr result
ID: Ziziphus21_contig00023219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00023219 (442 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010090143.1| hypothetical protein L484_027375 [Morus nota... 57 7e-06 ref|XP_002516284.1| conserved hypothetical protein [Ricinus comm... 57 7e-06 >ref|XP_010090143.1| hypothetical protein L484_027375 [Morus notabilis] gi|587848681|gb|EXB38940.1| hypothetical protein L484_027375 [Morus notabilis] Length = 641 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -3 Query: 326 IEDMGXXXXXXXXNTSDGVSQRVNSPRFSGPMTRRAPSFKR 204 ++DMG + SDGVSQRVNSPRFSGPMTRRA SFKR Sbjct: 1 MQDMGHHHHHHQHSPSDGVSQRVNSPRFSGPMTRRAHSFKR 41 >ref|XP_002516284.1| conserved hypothetical protein [Ricinus communis] gi|223544770|gb|EEF46286.1| conserved hypothetical protein [Ricinus communis] Length = 684 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 284 TSDGVSQRVNSPRFSGPMTRRAPSFKR 204 +SDGVSQRVNSPRFSGPMTRRAPSFKR Sbjct: 9 SSDGVSQRVNSPRFSGPMTRRAPSFKR 35