BLASTX nr result
ID: Ziziphus21_contig00021355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00021355 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010086544.1| BAG family molecular chaperone regulator 1 [... 65 2e-08 >ref|XP_010086544.1| BAG family molecular chaperone regulator 1 [Morus notabilis] gi|587828825|gb|EXB19761.1| BAG family molecular chaperone regulator 1 [Morus notabilis] Length = 297 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -1 Query: 366 QDNSIMHKSKPMQK-IQMPQEQRNFTAQKIVLQNPLQQSESVVVTTKWETFD 214 Q+NS+ +K KP+ K +Q P Q N+TAQK V Q PL+ SE+VVVTTKWETFD Sbjct: 246 QENSVNNKLKPVHKTMQQPLNQGNYTAQKPVFQRPLKHSENVVVTTKWETFD 297