BLASTX nr result
ID: Ziziphus21_contig00021262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00021262 (213 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206733.1| hypothetical protein PRUPE_ppa024822mg [Prun... 65 2e-08 ref|XP_003598872.1| LRR and NB-ARC domain disease resistance pro... 57 5e-06 ref|XP_009354493.1| PREDICTED: putative disease resistance prote... 57 7e-06 emb|CBI40193.3| unnamed protein product [Vitis vinifera] 56 9e-06 >ref|XP_007206733.1| hypothetical protein PRUPE_ppa024822mg [Prunus persica] gi|462402375|gb|EMJ07932.1| hypothetical protein PRUPE_ppa024822mg [Prunus persica] Length = 1076 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/69 (44%), Positives = 45/69 (65%) Frame = -1 Query: 210 GAFPKLRQLELRNCPKLSAACLPDYLPSLNTLRISESKKLLASLQGDQLPTLEVLELSHC 31 GAFP L +L LRNCPKL DY P L L++ +L+ +L LP+L+ ++++ C Sbjct: 867 GAFPDLCELRLRNCPKLRGRLPLDYFPKLKRLKLRSLPELMHTL----LPSLQSMDITEC 922 Query: 30 PEVESFPEG 4 PE+ESFP+G Sbjct: 923 PELESFPDG 931 >ref|XP_003598872.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] gi|355487920|gb|AES69123.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1351 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = -1 Query: 201 PKLRQLELRNCPKLSAACLPDYLPSLNTLRISESKKLLASLQGDQLPTLEVLELSHCPEV 22 P L+++ +RNCPKL A LP +LPSL L+I + KL L + P L+ + +S CPE+ Sbjct: 940 PLLKEISIRNCPKLKRALLPQHLPSLQKLKICDCNKLEELLCLGEFPLLKEISISDCPEL 999 Query: 21 E 19 + Sbjct: 1000 K 1000 >ref|XP_009354493.1| PREDICTED: putative disease resistance protein At3g14460 [Pyrus x bretschneideri] Length = 428 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/72 (45%), Positives = 41/72 (56%), Gaps = 11/72 (15%) Frame = -1 Query: 213 DGAFPKLRQLELRNCPKLSAACLPDYLPSLNTLRISESKKLLASLQGDQL---------- 64 DGAFP L QL L NCPKL+ LPDYLPSL TL + ++LL SL Q+ Sbjct: 193 DGAFPHLCQLYLENCPKLTEK-LPDYLPSLTTLEVRRREQLLGSLPNSQVILETPSNDGL 251 Query: 63 -PTLEVLELSHC 31 L VL++ +C Sbjct: 252 AYALSVLKIKYC 263 >emb|CBI40193.3| unnamed protein product [Vitis vinifera] Length = 908 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -1 Query: 207 AFPKLRQLELRNCPKLSAACLPDYLPSLNTLRISESKKLLASLQGDQLP-TLEVLELSHC 31 ++P+LR+LE+ +CPKL LP +LPSL L I + KL+A L LP LE LE++ C Sbjct: 549 SYPRLRELEIHHCPKLIQK-LPSHLPSLVKLDIIDCPKLVAPLPNQPLPCNLEYLEINKC 607 Query: 30 PEVESFPEG 4 +E P G Sbjct: 608 ASLEKLPIG 616