BLASTX nr result
ID: Ziziphus21_contig00021140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00021140 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010029771.1| PREDICTED: soluble inorganic pyrophosphatase... 63 1e-07 ref|XP_010029772.1| PREDICTED: soluble inorganic pyrophosphatase... 63 1e-07 gb|KCW56731.1| hypothetical protein EUGRSUZ_I02418 [Eucalyptus g... 63 1e-07 ref|XP_007204732.1| hypothetical protein PRUPE_ppa011346mg [Prun... 62 2e-07 ref|XP_004287880.1| PREDICTED: soluble inorganic pyrophosphatase... 61 3e-07 ref|XP_011658018.1| PREDICTED: soluble inorganic pyrophosphatase... 60 5e-07 ref|XP_004143524.1| PREDICTED: soluble inorganic pyrophosphatase... 60 5e-07 ref|XP_008440736.1| PREDICTED: soluble inorganic pyrophosphatase... 60 6e-07 ref|XP_008440735.1| PREDICTED: soluble inorganic pyrophosphatase... 60 6e-07 ref|XP_008241705.1| PREDICTED: soluble inorganic pyrophosphatase... 60 6e-07 gb|KDO70969.1| hypothetical protein CISIN_1g027710mg [Citrus sin... 60 6e-07 gb|KDO70967.1| hypothetical protein CISIN_1g027710mg [Citrus sin... 60 6e-07 ref|XP_006466825.1| PREDICTED: soluble inorganic pyrophosphatase... 60 6e-07 ref|XP_006466824.1| PREDICTED: soluble inorganic pyrophosphatase... 60 6e-07 ref|XP_006466823.1| PREDICTED: soluble inorganic pyrophosphatase... 60 6e-07 ref|XP_006425645.1| hypothetical protein CICLE_v10026346mg [Citr... 60 6e-07 ref|XP_006425644.1| hypothetical protein CICLE_v10026346mg [Citr... 60 6e-07 ref|XP_006425643.1| hypothetical protein CICLE_v10026346mg [Citr... 60 6e-07 ref|XP_010113422.1| Soluble inorganic pyrophosphatase [Morus not... 60 8e-07 ref|XP_009628780.1| PREDICTED: soluble inorganic pyrophosphatase... 60 8e-07 >ref|XP_010029771.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Eucalyptus grandis] Length = 222 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ Sbjct: 192 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 222 >ref|XP_010029772.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Eucalyptus grandis] gi|702467616|ref|XP_010029773.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Eucalyptus grandis] gi|702467620|ref|XP_010029774.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Eucalyptus grandis] gi|629090479|gb|KCW56732.1| hypothetical protein EUGRSUZ_I02418 [Eucalyptus grandis] Length = 214 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ Sbjct: 184 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 214 >gb|KCW56731.1| hypothetical protein EUGRSUZ_I02418 [Eucalyptus grandis] Length = 178 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ Sbjct: 148 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 178 >ref|XP_007204732.1| hypothetical protein PRUPE_ppa011346mg [Prunus persica] gi|462400263|gb|EMJ05931.1| hypothetical protein PRUPE_ppa011346mg [Prunus persica] Length = 214 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AIDAIKYSMDLYASYIVESLRQ Sbjct: 184 VEDFLPAEAAIDAIKYSMDLYASYIVESLRQ 214 >ref|XP_004287880.1| PREDICTED: soluble inorganic pyrophosphatase [Fragaria vesca subsp. vesca] Length = 216 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+A+DAIKYSMDLYASYIVESLRQ Sbjct: 186 VEDFLPAEAAVDAIKYSMDLYASYIVESLRQ 216 >ref|XP_011658018.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Cucumis sativus] gi|700193641|gb|KGN48845.1| hypothetical protein Csa_6G502810 [Cucumis sativus] Length = 214 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AIDAIKYSMDLYA+YIVESLRQ Sbjct: 184 VEDFLPAEAAIDAIKYSMDLYAAYIVESLRQ 214 >ref|XP_004143524.1| PREDICTED: soluble inorganic pyrophosphatase 1 isoform X1 [Cucumis sativus] Length = 239 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AIDAIKYSMDLYA+YIVESLRQ Sbjct: 209 VEDFLPAEAAIDAIKYSMDLYAAYIVESLRQ 239 >ref|XP_008440736.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Cucumis melo] gi|659080338|ref|XP_008440738.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Cucumis melo] Length = 214 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+A+DAIKYSMDLYA+YIVESLRQ Sbjct: 184 VEDFLPAEAAVDAIKYSMDLYAAYIVESLRQ 214 >ref|XP_008440735.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Cucumis melo] Length = 239 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+A+DAIKYSMDLYA+YIVESLRQ Sbjct: 209 VEDFLPAEAAVDAIKYSMDLYAAYIVESLRQ 239 >ref|XP_008241705.1| PREDICTED: soluble inorganic pyrophosphatase [Prunus mume] Length = 214 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLP E+AIDAIKYSMDLYASYIVESLRQ Sbjct: 184 VEDFLPTEAAIDAIKYSMDLYASYIVESLRQ 214 >gb|KDO70969.1| hypothetical protein CISIN_1g027710mg [Citrus sinensis] Length = 192 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 162 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 192 >gb|KDO70967.1| hypothetical protein CISIN_1g027710mg [Citrus sinensis] Length = 220 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 190 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 220 >ref|XP_006466825.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X3 [Citrus sinensis] Length = 214 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 184 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 214 >ref|XP_006466824.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 [Citrus sinensis] Length = 248 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 218 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 248 >ref|XP_006466823.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 [Citrus sinensis] Length = 283 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 253 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 283 >ref|XP_006425645.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|557527635|gb|ESR38885.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|641852103|gb|KDO70968.1| hypothetical protein CISIN_1g027710mg [Citrus sinensis] Length = 214 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 184 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 214 >ref|XP_006425644.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|557527634|gb|ESR38884.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] Length = 248 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 218 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 248 >ref|XP_006425643.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|557527633|gb|ESR38883.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|641852107|gb|KDO70972.1| hypothetical protein CISIN_1g027710mg [Citrus sinensis] gi|641852108|gb|KDO70973.1| hypothetical protein CISIN_1g027710mg [Citrus sinensis] Length = 179 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+AI+AIKYSMDLYASYIVESLRQ Sbjct: 149 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 179 >ref|XP_010113422.1| Soluble inorganic pyrophosphatase [Morus notabilis] gi|587949261|gb|EXC35449.1| Soluble inorganic pyrophosphatase [Morus notabilis] Length = 227 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VE+FLPAE+AIDAIKYSMDLYASYI+ESLRQ Sbjct: 197 VEEFLPAEAAIDAIKYSMDLYASYIIESLRQ 227 >ref|XP_009628780.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana tomentosiformis] gi|697098844|ref|XP_009628788.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana tomentosiformis] gi|698458022|ref|XP_009780964.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana sylvestris] gi|698458026|ref|XP_009780965.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana sylvestris] Length = 214 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 412 VEDFLPAESAIDAIKYSMDLYASYIVESLRQ 320 VEDFLPAE+A+DAIKYSMDLYASYIVESLR+ Sbjct: 184 VEDFLPAEAAVDAIKYSMDLYASYIVESLRK 214