BLASTX nr result
ID: Ziziphus21_contig00018130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00018130 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010108761.1| F-box protein [Morus notabilis] gi|587970663... 69 2e-09 >ref|XP_010108761.1| F-box protein [Morus notabilis] gi|587970663|gb|EXC55563.1| F-box protein [Morus notabilis] Length = 272 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = +1 Query: 190 MGCCGDEDEDDILKHLNPSISTESLTPNLHHXXXXXXXXXXXXXXPMNSHFSGLTCRD 363 MGCC DE++DDILKHLNPSIST++LT + PMNSHFS LTCRD Sbjct: 1 MGCCCDEEDDDILKHLNPSISTQTLTLDPCSSSTSFSGDCSDVISPMNSHFSALTCRD 58