BLASTX nr result
ID: Ziziphus21_contig00018105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00018105 (612 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010662220.1| PREDICTED: pentatricopeptide repeat-containi... 86 2e-14 emb|CBI38550.3| unnamed protein product [Vitis vinifera] 86 2e-14 emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] 86 2e-14 ref|XP_009364299.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-12 ref|XP_008337878.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-12 ref|XP_008231329.1| PREDICTED: pentatricopeptide repeat-containi... 74 8e-11 ref|XP_012070275.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 gb|KDP39562.1| hypothetical protein JCGZ_02582 [Jatropha curcas] 72 2e-10 ref|XP_006437400.1| hypothetical protein CICLE_v10030585mg [Citr... 72 2e-10 ref|XP_011012461.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_011012460.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_011012459.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 gb|KDO48045.1| hypothetical protein CISIN_1g001642mg [Citrus sin... 72 2e-10 ref|XP_006484704.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_002325452.2| hypothetical protein POPTR_0019s06000g [Popu... 72 2e-10 ref|XP_010097541.1| hypothetical protein L484_024754 [Morus nota... 71 5e-10 ref|XP_002524030.1| pentatricopeptide repeat-containing protein,... 70 7e-10 gb|KRH20481.1| hypothetical protein GLYMA_13G181600 [Glycine max] 67 6e-09 gb|KHN10022.1| Pentatricopeptide repeat-containing protein, mito... 67 6e-09 ref|XP_011650052.1| PREDICTED: pentatricopeptide repeat-containi... 67 8e-09 >ref|XP_010662220.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Vitis vinifera] gi|731422724|ref|XP_010662221.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Vitis vinifera] Length = 850 Score = 85.9 bits (211), Expect = 2e-14 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW+KLSKQP+L++ LKRSYQAEAKRL+EEM EK + PC+ T CIS L + Sbjct: 773 TYDILICGWYKLSKQPELNKSLKRSYQAEAKRLFEEMNEKGFIPCENTLACISFTLAKPG 832 Query: 427 K 425 K Sbjct: 833 K 833 >emb|CBI38550.3| unnamed protein product [Vitis vinifera] Length = 795 Score = 85.9 bits (211), Expect = 2e-14 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW+KLSKQP+L++ LKRSYQAEAKRL+EEM EK + PC+ T CIS L + Sbjct: 718 TYDILICGWYKLSKQPELNKSLKRSYQAEAKRLFEEMNEKGFIPCENTLACISFTLAKPG 777 Query: 427 K 425 K Sbjct: 778 K 778 >emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] Length = 882 Score = 85.9 bits (211), Expect = 2e-14 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW+KLSKQP+L++ LKRSYQAEAKRL+EEM EK + PC+ T CIS L + Sbjct: 718 TYDILICGWYKLSKQPELNKSLKRSYQAEAKRLFEEMNEKGFIPCENTLACISFTLAKPG 777 Query: 427 K 425 K Sbjct: 778 K 778 >ref|XP_009364299.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Pyrus x bretschneideri] Length = 1021 Score = 78.6 bits (192), Expect = 3e-12 Identities = 36/61 (59%), Positives = 47/61 (77%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TY+ILI GW +LS+QP+L+R LK+SY+AEAKRL +MKEK Y PC+ T LCIS+ + Sbjct: 944 TYNILICGWCRLSRQPELERNLKKSYRAEAKRLLTDMKEKGYVPCESTVLCISSTFARPG 1003 Query: 427 K 425 K Sbjct: 1004 K 1004 >ref|XP_008337878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Malus domestica] Length = 1021 Score = 78.6 bits (192), Expect = 3e-12 Identities = 36/61 (59%), Positives = 47/61 (77%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TY+ILI GW +LS+QP+L+R LK+SY+AEAKRL +MKEK Y PC+ T LCIS+ + Sbjct: 944 TYNILICGWCRLSRQPELERNLKKSYRAEAKRLLTDMKEKGYVPCESTVLCISSTFARPG 1003 Query: 427 K 425 K Sbjct: 1004 K 1004 >ref|XP_008231329.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Prunus mume] gi|645250697|ref|XP_008231330.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Prunus mume] Length = 1025 Score = 73.6 bits (179), Expect = 8e-11 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TY+ILI GW KLSK P+L+R LKRSY+ EAKRL +M EK Y PC+ T CIS+ + Sbjct: 948 TYNILICGWCKLSKHPELERNLKRSYRDEAKRLLTDMNEKGYVPCESTLRCISSAFARPG 1007 Query: 427 K 425 K Sbjct: 1008 K 1008 >ref|XP_012070275.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Jatropha curcas] Length = 1040 Score = 72.4 bits (176), Expect = 2e-10 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQ 434 TYDILI GW LSKQP LDR+LK++Y+ EAK+L EM EK + PC+ T C+S+ + Sbjct: 963 TYDILICGWCNLSKQPDLDRILKKNYRTEAKKLIIEMNEKGFVPCESTIACVSSTFAR 1020 >gb|KDP39562.1| hypothetical protein JCGZ_02582 [Jatropha curcas] Length = 195 Score = 72.4 bits (176), Expect = 2e-10 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQ 434 TYDILI GW LSKQP LDR+LK++Y+ EAK+L EM EK + PC+ T C+S+ + Sbjct: 118 TYDILICGWCNLSKQPDLDRILKKNYRTEAKKLIIEMNEKGFVPCESTIACVSSTFAR 175 >ref|XP_006437400.1| hypothetical protein CICLE_v10030585mg [Citrus clementina] gi|557539596|gb|ESR50640.1| hypothetical protein CICLE_v10030585mg [Citrus clementina] Length = 1039 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW +LS +P+LDR L SY+AEAK+L+ EM EK + PC+ TQ C S+ + Sbjct: 962 TYDILISGWCELSNEPELDRTLILSYRAEAKKLFMEMNEKGFVPCESTQTCFSSTFARPG 1021 Query: 427 K 425 K Sbjct: 1022 K 1022 >ref|XP_011012461.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial isoform X3 [Populus euphratica] Length = 973 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQ 434 TYDILI GW LSKQP+LDR+ K++Y+ EA+ L+ EM EK + PC+ T CIS+ + Sbjct: 896 TYDILICGWCNLSKQPELDRISKKTYRTEARTLFTEMNEKGFVPCENTLACISSTFAR 953 >ref|XP_011012460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial isoform X2 [Populus euphratica] Length = 1000 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQ 434 TYDILI GW LSKQP+LDR+ K++Y+ EA+ L+ EM EK + PC+ T CIS+ + Sbjct: 923 TYDILICGWCNLSKQPELDRISKKTYRTEARTLFTEMNEKGFVPCENTLACISSTFAR 980 >ref|XP_011012459.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial isoform X1 [Populus euphratica] Length = 1024 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQ 434 TYDILI GW LSKQP+LDR+ K++Y+ EA+ L+ EM EK + PC+ T CIS+ + Sbjct: 947 TYDILICGWCNLSKQPELDRISKKTYRTEARTLFTEMNEKGFVPCENTLACISSTFAR 1004 >gb|KDO48045.1| hypothetical protein CISIN_1g001642mg [Citrus sinensis] gi|641828910|gb|KDO48046.1| hypothetical protein CISIN_1g001642mg [Citrus sinensis] Length = 1039 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW +LS +P+LDR L SY+AEAK+L+ EM EK + PC+ TQ C S+ + Sbjct: 962 TYDILIGGWCELSNEPELDRTLILSYRAEAKKLFMEMNEKGFVPCESTQTCFSSTFARPG 1021 Query: 427 K 425 K Sbjct: 1022 K 1022 >ref|XP_006484704.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Citrus sinensis] Length = 1039 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW +LS +P+LDR L SY+AEAK+L+ EM EK + PC+ TQ C S+ + Sbjct: 962 TYDILIGGWCELSNEPELDRTLILSYRAEAKKLFMEMNEKGFVPCESTQTCFSSTFARPG 1021 Query: 427 K 425 K Sbjct: 1022 K 1022 >ref|XP_002325452.2| hypothetical protein POPTR_0019s06000g [Populus trichocarpa] gi|550316902|gb|EEE99833.2| hypothetical protein POPTR_0019s06000g [Populus trichocarpa] Length = 941 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQ 434 TYDILI GW LSKQP+LDR+ K++Y+ EA+ L+ EM EK + PC+ T CIS+ + Sbjct: 864 TYDILICGWCNLSKQPELDRISKKTYRTEARTLFAEMNEKGFVPCENTLACISSTFAR 921 >ref|XP_010097541.1| hypothetical protein L484_024754 [Morus notabilis] gi|587879769|gb|EXB68732.1| hypothetical protein L484_024754 [Morus notabilis] Length = 1019 Score = 70.9 bits (172), Expect = 5e-10 Identities = 36/61 (59%), Positives = 41/61 (67%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW KLSK+P L+R LK+SY EAKRL EM EK Y PC TQ IS+ + Sbjct: 942 TYDILIRGWCKLSKRPALERPLKKSYLVEAKRLLVEMHEKGYVPCGSTQQYISSTFARPG 1001 Query: 427 K 425 K Sbjct: 1002 K 1002 >ref|XP_002524030.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536757|gb|EEF38398.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1016 Score = 70.5 bits (171), Expect = 7e-10 Identities = 32/63 (50%), Positives = 41/63 (65%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW LSK P LDR LK+ Y+ +AK L EM +K + PCK T CIS+ + Sbjct: 869 TYDILICGWCNLSKHPDLDRTLKKIYRTDAKNLITEMNDKGFVPCKSTIACISSTFARPG 928 Query: 427 KLM 419 K++ Sbjct: 929 KML 931 >gb|KRH20481.1| hypothetical protein GLYMA_13G181600 [Glycine max] Length = 928 Score = 67.4 bits (163), Expect = 6e-09 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCIS 449 TYD+LI GWWKLS QP++DR+LK SYQ EAK L EM EK + P + T + IS Sbjct: 876 TYDVLICGWWKLSCQPEMDRLLKLSYQNEAKILLREMCEKGHVPSESTLMYIS 928 >gb|KHN10022.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 797 Score = 67.4 bits (163), Expect = 6e-09 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCIS 449 TYD+LI GWWKLS QP++DR+LK SYQ EAK L EM EK + P + T + IS Sbjct: 745 TYDVLICGWWKLSCQPEMDRLLKLSYQNEAKILLREMCEKGHVPSESTLMYIS 797 >ref|XP_011650052.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673749|ref|XP_011650053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673753|ref|XP_011650054.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673757|ref|XP_011650056.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673760|ref|XP_004151848.2| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|700208231|gb|KGN63350.1| hypothetical protein Csa_2G431190 [Cucumis sativus] Length = 785 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = -3 Query: 607 TYDILIYGWWKLSKQPQLDRMLKRSYQAEAKRLYEEMKEKQYAPCKRTQLCISAVLGQER 428 TYDILI GW L K P L LK SY+AEAKRL+ EM ++ + PC+ TQ CIS+ Sbjct: 708 TYDILICGWCNLLKMPDLGSTLKISYRAEAKRLFIEMNDRGFVPCESTQACISSTFAAPG 767 Query: 427 K 425 K Sbjct: 768 K 768