BLASTX nr result
ID: Ziziphus21_contig00018101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00018101 (513 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102198.1| ATP-dependent zinc metalloprotease FtsH [Mor... 64 3e-08 >ref|XP_010102198.1| ATP-dependent zinc metalloprotease FtsH [Morus notabilis] gi|587904945|gb|EXB93141.1| ATP-dependent zinc metalloprotease FtsH [Morus notabilis] Length = 1305 Score = 64.3 bits (155), Expect = 3e-08 Identities = 41/71 (57%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = -3 Query: 208 MDAIAASRLLPSPFAPHFSPPTLRNSYLAS--NHRIRIQIFASKSPKFHRIFFPVRYGFG 35 MDAI ASRLLPS F+P FS P S S RIRIQ SK PKF F PV Y F Sbjct: 1 MDAILASRLLPSHFSPLFSSPHRNPSLPLSLRTRRIRIQRLPSKWPKFRPKFSPVGYNFI 60 Query: 34 AFSSLEAHRNS 2 FSSLEA R+S Sbjct: 61 VFSSLEASRSS 71