BLASTX nr result
ID: Ziziphus21_contig00018024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00018024 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010276347.1| PREDICTED: mediator of RNA polymerase II tra... 206 7e-51 ref|XP_010276346.1| PREDICTED: mediator of RNA polymerase II tra... 206 7e-51 ref|XP_010276344.1| PREDICTED: mediator of RNA polymerase II tra... 206 7e-51 ref|XP_010058503.1| PREDICTED: mediator of RNA polymerase II tra... 201 1e-49 ref|XP_008241147.1| PREDICTED: mediator of RNA polymerase II tra... 201 2e-49 ref|XP_002531587.1| Cofactor required for Sp1 transcriptional ac... 201 2e-49 ref|XP_010276345.1| PREDICTED: mediator of RNA polymerase II tra... 200 3e-49 emb|CDP04358.1| unnamed protein product [Coffea canephora] 200 3e-49 ref|XP_009350790.1| PREDICTED: mediator of RNA polymerase II tra... 199 5e-49 ref|XP_008391554.1| PREDICTED: mediator of RNA polymerase II tra... 199 5e-49 ref|XP_012090858.1| PREDICTED: mediator of RNA polymerase II tra... 199 7e-49 ref|XP_007029122.1| Mediator of RNA polymerase II transcription ... 199 7e-49 gb|KDO70785.1| hypothetical protein CISIN_1g030977mg [Citrus sin... 199 9e-49 ref|XP_006481684.1| PREDICTED: mediator of RNA polymerase II tra... 199 9e-49 ref|XP_006429955.1| hypothetical protein CICLE_v10012936mg [Citr... 199 9e-49 ref|XP_010909698.1| PREDICTED: mediator of RNA polymerase II tra... 198 1e-48 ref|XP_011039524.1| PREDICTED: mediator of RNA polymerase II tra... 198 2e-48 ref|XP_002323352.1| hypothetical protein POPTR_0016s06270g [Popu... 198 2e-48 ref|XP_004136548.1| PREDICTED: mediator of RNA polymerase II tra... 198 2e-48 ref|XP_009781488.1| PREDICTED: mediator of RNA polymerase II tra... 197 3e-48 >ref|XP_010276347.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X4 [Nelumbo nucifera] Length = 170 Score = 206 bits (523), Expect = 7e-51 Identities = 102/109 (93%), Positives = 107/109 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 62 QLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 121 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALDAH 119 LRPHQARAT+IHILELQIQRRKQAVEDI+RRREEAQRLLKESLG LD H Sbjct: 122 LRPHQARATLIHILELQIQRRKQAVEDIRRRREEAQRLLKESLGTLDGH 170 >ref|XP_010276346.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X3 [Nelumbo nucifera] Length = 187 Score = 206 bits (523), Expect = 7e-51 Identities = 102/109 (93%), Positives = 107/109 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 79 QLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 138 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALDAH 119 LRPHQARAT+IHILELQIQRRKQAVEDI+RRREEAQRLLKESLG LD H Sbjct: 139 LRPHQARATLIHILELQIQRRKQAVEDIRRRREEAQRLLKESLGTLDGH 187 >ref|XP_010276344.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X1 [Nelumbo nucifera] Length = 200 Score = 206 bits (523), Expect = 7e-51 Identities = 102/109 (93%), Positives = 107/109 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 92 QLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 151 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALDAH 119 LRPHQARAT+IHILELQIQRRKQAVEDI+RRREEAQRLLKESLG LD H Sbjct: 152 LRPHQARATLIHILELQIQRRKQAVEDIRRRREEAQRLLKESLGTLDGH 200 >ref|XP_010058503.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a [Eucalyptus grandis] gi|629125942|gb|KCW90367.1| hypothetical protein EUGRSUZ_A02508 [Eucalyptus grandis] Length = 168 Score = 201 bits (512), Expect = 1e-49 Identities = 99/109 (90%), Positives = 106/109 (97%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLH+LELADVLV+RPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNIDFKKELRSLNRELQLHLLELADVLVERPSQYARRVEEISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALDAH 119 LRPHQARAT+IHILELQIQ+RKQAVEDIKRRREE QRLLKESLG LD H Sbjct: 120 LRPHQARATLIHILELQIQQRKQAVEDIKRRREEVQRLLKESLGTLDGH 168 >ref|XP_008241147.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Prunus mume] Length = 175 Score = 201 bits (511), Expect = 2e-49 Identities = 99/107 (92%), Positives = 106/107 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILELAD+LV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNIDFKKELRSLNRELQLHILELADILVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIKRRREEAQRLLKES+G L+ Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKESIGTLE 166 >ref|XP_002531587.1| Cofactor required for Sp1 transcriptional activation subunit, putative [Ricinus communis] gi|223528783|gb|EEF30790.1| Cofactor required for Sp1 transcriptional activation subunit, putative [Ricinus communis] Length = 168 Score = 201 bits (510), Expect = 2e-49 Identities = 100/107 (93%), Positives = 106/107 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPNVD+KKELRSLNRELQLHILEL+DVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNVDFKKELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIKRRREEAQ+LLKE+LG LD Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQKLLKEALGTLD 166 >ref|XP_010276345.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X2 [Nelumbo nucifera] Length = 199 Score = 200 bits (509), Expect = 3e-49 Identities = 102/109 (93%), Positives = 106/109 (97%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 92 QLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 151 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALDAH 119 LRPHQARAT+IHILELQIQRRKQAVEDI RRREEAQRLLKESLG LD H Sbjct: 152 LRPHQARATLIHILELQIQRRKQAVEDI-RRREEAQRLLKESLGTLDGH 199 >emb|CDP04358.1| unnamed protein product [Coffea canephora] Length = 168 Score = 200 bits (509), Expect = 3e-49 Identities = 98/107 (91%), Positives = 106/107 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPNVD+KKELR+LNRELQLHILELAD+L++RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNVDFKKELRALNRELQLHILELADILIERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILE+QIQRRKQAVEDIKRRREEAQRLLKE+LG LD Sbjct: 120 LRPHQARATLIHILEIQIQRRKQAVEDIKRRREEAQRLLKEALGTLD 166 >ref|XP_009350790.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694451074|ref|XP_009350791.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694451078|ref|XP_009350792.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] Length = 175 Score = 199 bits (507), Expect = 5e-49 Identities = 98/107 (91%), Positives = 106/107 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILELAD+LV+RPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNIDFKKELRSLNRELQLHILELADILVERPSQYARRVEEISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIKRRREEAQRLLKES+G L+ Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKESIGTLE 166 >ref|XP_008391554.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Malus domestica] gi|657998309|ref|XP_008391555.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Malus domestica] gi|694415356|ref|XP_009335858.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694415359|ref|XP_009335859.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694415361|ref|XP_009335860.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] Length = 175 Score = 199 bits (507), Expect = 5e-49 Identities = 98/107 (91%), Positives = 106/107 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILELAD+LV+RPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNIDFKKELRSLNRELQLHILELADILVERPSQYARRVEEISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIKRRREEAQRLLKES+G L+ Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKESIGTLE 166 >ref|XP_012090858.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a isoform X1 [Jatropha curcas] gi|643705364|gb|KDP21910.1| hypothetical protein JCGZ_03048 [Jatropha curcas] Length = 170 Score = 199 bits (506), Expect = 7e-49 Identities = 100/107 (93%), Positives = 105/107 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPNVD+KKELRSLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIK RREEAQ+LLKE+LG LD Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKGRREEAQKLLKEALGTLD 166 >ref|XP_007029122.1| Mediator of RNA polymerase II transcription subunit 7 isoform 3 [Theobroma cacao] gi|508717727|gb|EOY09624.1| Mediator of RNA polymerase II transcription subunit 7 isoform 3 [Theobroma cacao] Length = 168 Score = 199 bits (506), Expect = 7e-49 Identities = 100/107 (93%), Positives = 105/107 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPNVD+KKELRSLNRELQLHILELADVLV+RPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQA+EDIK RREEAQRLLKESLG LD Sbjct: 120 LRPHQARATLIHILELQIQRRKQALEDIKSRREEAQRLLKESLGTLD 166 >gb|KDO70785.1| hypothetical protein CISIN_1g030977mg [Citrus sinensis] Length = 168 Score = 199 bits (505), Expect = 9e-49 Identities = 99/107 (92%), Positives = 105/107 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILEL+DVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNIDFKKELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIKRRREEAQR LKESLG L+ Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRRLKESLGTLE 166 >ref|XP_006481684.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Citrus sinensis] Length = 168 Score = 199 bits (505), Expect = 9e-49 Identities = 99/107 (92%), Positives = 105/107 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILEL+DVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNIDFKKELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIKRRREEAQR LKESLG L+ Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRRLKESLGTLE 166 >ref|XP_006429955.1| hypothetical protein CICLE_v10012936mg [Citrus clementina] gi|557532012|gb|ESR43195.1| hypothetical protein CICLE_v10012936mg [Citrus clementina] Length = 168 Score = 199 bits (505), Expect = 9e-49 Identities = 99/107 (92%), Positives = 105/107 (98%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKELRSLNRELQLHILEL+DVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNIDFKKELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQAVEDIKRRREEAQR LKESLG L+ Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRRLKESLGTLE 166 >ref|XP_010909698.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X2 [Elaeis guineensis] Length = 174 Score = 198 bits (504), Expect = 1e-48 Identities = 98/109 (89%), Positives = 105/109 (96%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPN+D+KKEL+SLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 64 QLYPKGPNIDFKKELQSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 123 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALDAH 119 LRPHQARAT+IHILE QIQRRKQA+EDIKRRREEA+RLLKESL LD H Sbjct: 124 LRPHQARATLIHILECQIQRRKQAIEDIKRRREEARRLLKESLQTLDGH 172 >ref|XP_011039524.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a isoform X1 [Populus euphratica] gi|743892032|ref|XP_011039526.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a isoform X2 [Populus euphratica] Length = 168 Score = 198 bits (503), Expect = 2e-48 Identities = 99/106 (93%), Positives = 105/106 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPNVD+KKELRSLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGAL 128 LRPHQARAT+IHILELQIQRRKQAVEDIKR+REEAQ+LLKE+LG L Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRQREEAQKLLKEALGTL 165 >ref|XP_002323352.1| hypothetical protein POPTR_0016s06270g [Populus trichocarpa] gi|222867982|gb|EEF05113.1| hypothetical protein POPTR_0016s06270g [Populus trichocarpa] Length = 168 Score = 198 bits (503), Expect = 2e-48 Identities = 99/106 (93%), Positives = 105/106 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPNVD+KKELRSLNRELQLHILELADVLV+RPSQYARRVEDISLIFKNLHHLLNS Sbjct: 60 QLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGAL 128 LRPHQARAT+IHILELQIQRRKQAVEDIKR+REEAQ+LLKE+LG L Sbjct: 120 LRPHQARATLIHILELQIQRRKQAVEDIKRQREEAQKLLKEALGTL 165 >ref|XP_004136548.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Cucumis sativus] gi|659084657|ref|XP_008443001.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Cucumis melo] gi|700204130|gb|KGN59263.1| hypothetical protein Csa_3G791540 [Cucumis sativus] Length = 168 Score = 198 bits (503), Expect = 2e-48 Identities = 98/109 (89%), Positives = 105/109 (96%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYP+GPNVDYKKELRSLNRELQLHILELAD+LV+RPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 60 QLYPRGPNVDYKKELRSLNRELQLHILELADILVERPSQYARRVEEISLIFKNLHHLLNS 119 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALDAH 119 LRPHQARAT+IHILELQI+RR+QAVEDIKRRREEAQRLL ESL LD H Sbjct: 120 LRPHQARATLIHILELQIERRRQAVEDIKRRREEAQRLLMESLETLDGH 168 >ref|XP_009781488.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7b-like isoform X2 [Nicotiana sylvestris] Length = 138 Score = 197 bits (501), Expect = 3e-48 Identities = 97/107 (90%), Positives = 106/107 (99%) Frame = -2 Query: 445 QLYPKGPNVDYKKELRSLNRELQLHILELADVLVQRPSQYARRVEDISLIFKNLHHLLNS 266 QLYPKGPNVD+KKELR+LNRELQLHILELADVLV+RPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 30 QLYPKGPNVDFKKELRALNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNS 89 Query: 265 LRPHQARATIIHILELQIQRRKQAVEDIKRRREEAQRLLKESLGALD 125 LRPHQARAT+IHILELQIQRRKQA+EDIKRRREEAQ+LLKE+LG L+ Sbjct: 90 LRPHQARATLIHILELQIQRRKQAIEDIKRRREEAQKLLKEALGTLE 136