BLASTX nr result
ID: Ziziphus21_contig00015895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00015895 (484 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098867.1| hypothetical protein L484_022634 [Morus nota... 67 4e-09 ref|XP_009602768.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_009798335.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_010037103.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 >ref|XP_010098867.1| hypothetical protein L484_022634 [Morus notabilis] gi|587887154|gb|EXB75955.1| hypothetical protein L484_022634 [Morus notabilis] Length = 911 Score = 67.4 bits (163), Expect = 4e-09 Identities = 44/96 (45%), Positives = 59/96 (61%), Gaps = 13/96 (13%) Frame = -3 Query: 251 NYVFFAASATQSLLPPKP-------------QPLFTSGSFDDPSSPEIRSGCDIHGLLDL 111 N+VFF+AS TQSL +P +PLF S F++ SS D+ GLL L Sbjct: 47 NHVFFSASQTQSLACLEPFSIKQQRQQQQQQKPLFDSELFENCSSLSNFVEFDVDGLLHL 106 Query: 110 LRLSARCGDVELAKAVHAFILKVEEEDIFLSNALIA 3 L+LS R DVELAKAVHA ++K+ ED++L N+LI+ Sbjct: 107 LQLSVRYNDVELAKAVHASVVKL-GEDVYLGNSLIS 141 >ref|XP_009602768.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Nicotiana tomentosiformis] Length = 890 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -3 Query: 197 QPLFTSGSFDDPSSPEIRSGCDIHGLLDLLRLSARCGDVELAKAVHAFILKVEEEDIFLS 18 QPL F D S+ + + + +LLR+S RCGDVELAK +H+ ILK+EEED++L Sbjct: 57 QPLLIPQHFKD-SNVTVAADTNRIDYANLLRISVRCGDVELAKIIHSSILKLEEEDVYLK 115 Query: 17 NALIA 3 NALIA Sbjct: 116 NALIA 120 >ref|XP_009798335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Nicotiana sylvestris] Length = 890 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 116 DLLRLSARCGDVELAKAVHAFILKVEEEDIFLSNALIA 3 +LLR+S RCGDVELAK +H+ ILK+EEED++L NALIA Sbjct: 83 NLLRISVRCGDVELAKIIHSSILKLEEEDVYLKNALIA 120 >ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Solanum tuberosum] Length = 894 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = -3 Query: 197 QPLFTSGSFDDPSSPEIRSGCDIHGLLDLLRLSARCGDVELAKAVHAFILKVEEEDIFLS 18 QPL T F D S+ + S + +LLR+S RCGDV L K +H+ ++K EEED++L Sbjct: 60 QPLLTPQQFKD-SNVSVDSDTNCIDYANLLRISVRCGDVVLTKIIHSSLVKFEEEDVYLK 118 Query: 17 NALIA 3 NALIA Sbjct: 119 NALIA 123 >ref|XP_010037103.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Eucalyptus grandis] gi|629082323|gb|KCW48768.1| hypothetical protein EUGRSUZ_K02412 [Eucalyptus grandis] Length = 906 Score = 57.0 bits (136), Expect = 5e-06 Identities = 42/92 (45%), Positives = 51/92 (55%), Gaps = 15/92 (16%) Frame = -3 Query: 236 AASATQ--------SLLPPKPQP----LFTSGSFDDPSSPEIRS--GCDIHGLLDLLRLS 99 AAS+TQ S LPP +P LF S FD P P+ + G DLLR S Sbjct: 44 AASSTQFPSPRPPPSPLPPPCRPESRRLFASEPFDGPPPPDAAAAVGSLTDDCFDLLRFS 103 Query: 98 ARCGDVELAKAVHAFILKVE-EEDIFLSNALI 6 CGDV+LA+AVHA L++E EE+ L NALI Sbjct: 104 VGCGDVDLARAVHAVFLRLELEENPSLGNALI 135