BLASTX nr result
ID: Ziziphus21_contig00015857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00015857 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB21688.1| hypothetical protein B456_004G008900 [Gossypium r... 57 4e-06 >gb|KJB21688.1| hypothetical protein B456_004G008900 [Gossypium raimondii] Length = 182 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/68 (51%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = -2 Query: 201 AEPATFSLHESSTIASIQ-SPKMKXXXXXXXXXLGGNSTPSANDLKKILSSVGAEADDDR 25 A P+ F S S+ KMK LGGN++PSA+DLK IL SVGAEADDDR Sbjct: 47 ANPSFFVFLRGSISRSLDIKVKMKVVAAYLLAVLGGNASPSADDLKVILGSVGAEADDDR 106 Query: 24 ISFLLSEL 1 I LLSE+ Sbjct: 107 IELLLSEV 114