BLASTX nr result
ID: Ziziphus21_contig00015610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00015610 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008393178.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_009351131.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_008232760.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 ref|XP_007207533.1| hypothetical protein PRUPE_ppa015196mg [Prun... 72 1e-10 gb|KDO59915.1| hypothetical protein CISIN_1g039792mg [Citrus sin... 72 2e-10 ref|XP_006494746.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_006428022.1| hypothetical protein CICLE_v10024954mg [Citr... 72 2e-10 ref|XP_014497600.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 gb|KOM30655.1| hypothetical protein LR48_Vigan01g020900 [Vigna a... 70 6e-10 ref|XP_007159760.1| hypothetical protein PHAVU_002G264900g [Phas... 69 1e-09 gb|KHN29112.1| Pentatricopeptide repeat-containing protein [Glyc... 68 2e-09 ref|XP_003532850.2| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_007048121.1| Tetratricopeptide repeat (TPR)-like superfam... 68 2e-09 ref|XP_008457961.1| PREDICTED: uncharacterized protein LOC103497... 68 3e-09 gb|KHN38224.1| Pentatricopeptide repeat-containing protein [Glyc... 67 5e-09 ref|XP_004493200.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_010069315.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 gb|KCW57624.1| hypothetical protein EUGRSUZ_H00390 [Eucalyptus g... 64 3e-08 emb|CAN67343.1| hypothetical protein VITISV_038220 [Vitis vinifera] 64 3e-08 gb|KCW57628.1| hypothetical protein EUGRSUZ_H00398, partial [Euc... 63 1e-07 >ref|XP_008393178.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Malus domestica] Length = 844 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 WVEVNNEVH F ARDR H EAD+IFS+LDNLILQ+KG GYVPD T L Sbjct: 794 WVEVNNEVHTFAARDRTHREADLIFSILDNLILQIKGVGYVPDITTL 840 >ref|XP_009351131.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Pyrus x bretschneideri] gi|694452324|ref|XP_009351132.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Pyrus x bretschneideri] gi|694452327|ref|XP_009351133.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Pyrus x bretschneideri] gi|694452331|ref|XP_009351134.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Pyrus x bretschneideri] gi|694452334|ref|XP_009351136.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Pyrus x bretschneideri] Length = 841 Score = 77.4 bits (189), Expect = 4e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 WVEVNN+VH F ARDR H EAD+IFS+LDNLILQ+KG YVPD T L Sbjct: 791 WVEVNNDVHTFAARDRTHREADLIFSILDNLILQIKGVDYVPDITTL 837 >ref|XP_008232760.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Prunus mume] Length = 844 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 WVE NNEVH F A+DR H E +I S+LD+LILQMKG GYVPDTT L Sbjct: 794 WVEANNEVHTFAAKDRTHRETGLILSILDSLILQMKGLGYVPDTTTL 840 >ref|XP_007207533.1| hypothetical protein PRUPE_ppa015196mg [Prunus persica] gi|462403175|gb|EMJ08732.1| hypothetical protein PRUPE_ppa015196mg [Prunus persica] Length = 737 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 WVE NNEVH F A+DR H + +I S+LD+LILQMKG GYVPDTT L Sbjct: 687 WVEANNEVHTFAAKDRTHRKTGLILSILDSLILQMKGLGYVPDTTTL 733 >gb|KDO59915.1| hypothetical protein CISIN_1g039792mg [Citrus sinensis] Length = 819 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 W+EVNNEVH FVARD+ H AD+ +S+LDNLIL +KG GYVP+T+ L Sbjct: 772 WIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSAL 818 >ref|XP_006494746.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Citrus sinensis] Length = 850 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 W+EVNNEVH FVARD+ H AD+ +S+LDNLIL +KG GYVP+T+ L Sbjct: 803 WIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSAL 849 >ref|XP_006428022.1| hypothetical protein CICLE_v10024954mg [Citrus clementina] gi|557530012|gb|ESR41262.1| hypothetical protein CICLE_v10024954mg [Citrus clementina] Length = 759 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 W+EVNNEVH FVARD+ H AD+ +S+LDNLIL +KG GYVP+T+ L Sbjct: 712 WIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSAL 758 >ref|XP_014497600.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Vigna radiata var. radiata] Length = 848 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTMLF 199 W+EVNNEVH+F+ARD H ++ +I VLDNLILQ+KG GYVP+T F Sbjct: 798 WIEVNNEVHRFIARDTAHRDSTLISFVLDNLILQIKGFGYVPNTATFF 845 >gb|KOM30655.1| hypothetical protein LR48_Vigan01g020900 [Vigna angularis] Length = 870 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTMLF 199 W+EVNNEVH+F+ARD H ++ +I VLDNLILQ+KG GYVP+T F Sbjct: 820 WIEVNNEVHRFIARDTAHRDSTLISLVLDNLILQIKGFGYVPNTATFF 867 >ref|XP_007159760.1| hypothetical protein PHAVU_002G264900g [Phaseolus vulgaris] gi|561033175|gb|ESW31754.1| hypothetical protein PHAVU_002G264900g [Phaseolus vulgaris] Length = 846 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTMLF**MIDN 181 W+EVNNEVH+F+ARD H ++ +I VLDNLILQ+KG G+VP+T F IDN Sbjct: 796 WIEVNNEVHRFIARDTAHRDSTLISLVLDNLILQIKGFGHVPNTATFF---IDN 846 >gb|KHN29112.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 849 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTMLF 199 W+EVNNEVH+F+ARD H ++ +I VLDNLILQ+KG GYVP+ F Sbjct: 799 WIEVNNEVHRFIARDTAHRDSTLISLVLDNLILQIKGFGYVPNAATFF 846 >ref|XP_003532850.2| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Glycine max] gi|947094728|gb|KRH43313.1| hypothetical protein GLYMA_08G141600 [Glycine max] Length = 850 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTMLF 199 W+EVNNEVH+F+ARD H ++ +I VLDNLILQ+KG GYVP+ F Sbjct: 800 WIEVNNEVHRFIARDTAHRDSTLISLVLDNLILQIKGFGYVPNAATFF 847 >ref|XP_007048121.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508700382|gb|EOX92278.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 847 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPD 214 W+EVNNE + F+ARDR H EA++I+ VLDNLI+ +KG+GYVPD Sbjct: 798 WIEVNNETNVFIARDRTHHEANLIYLVLDNLIMHIKGAGYVPD 840 >ref|XP_008457961.1| PREDICTED: uncharacterized protein LOC103497526 [Cucumis melo] Length = 1703 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 W+E+N EVH FV+RD+VH E D+I+ LD L +QMK +G VPDTT+L Sbjct: 795 WIEINGEVHTFVSRDKVHDETDLIYLALDELTMQMKDAGSVPDTTIL 841 >gb|KHN38224.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 884 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTMLF**MIDNQIV 172 W+EVNNEVH+F+AR H ++ +I VLDNLILQ+KG GYVP+T F + NQ V Sbjct: 800 WIEVNNEVHRFIARGTAHRDSILISLVLDNLILQIKGFGYVPNTATFFLMIDINQTV 856 >ref|XP_004493200.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Cicer arietinum] Length = 852 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 W+EVNNE+HKF+ARD H ++ +I VLDNL+LQ+KG GYV +T L Sbjct: 802 WIEVNNEIHKFLARDTTHGDSTLISLVLDNLLLQIKGFGYVANTDAL 848 >ref|XP_010069315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Eucalyptus grandis] Length = 848 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPD 214 W+EVNNE H FVARD+ H EAD+I+SVL+ LILQ K GYVP+ Sbjct: 798 WIEVNNEAHVFVARDQTHYEADLIYSVLNYLILQTKEIGYVPN 840 >gb|KCW57624.1| hypothetical protein EUGRSUZ_H00390 [Eucalyptus grandis] Length = 723 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPD 214 W+EVNNE H FVARD+ H EAD+I+SVL+ LILQ K GYVP+ Sbjct: 673 WIEVNNEAHVFVARDQTHYEADLIYSVLNYLILQTKEIGYVPN 715 >emb|CAN67343.1| hypothetical protein VITISV_038220 [Vitis vinifera] Length = 732 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPDTTML 202 W+EVNN+V+ F+AR H EADMI SVLD LI +KG+GYVPD T L Sbjct: 682 WIEVNNKVNVFIARXTTHREADMIGSVLDILIQHIKGAGYVPDATAL 728 >gb|KCW57628.1| hypothetical protein EUGRSUZ_H00398, partial [Eucalyptus grandis] Length = 740 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 342 WVEVNNEVHKFVARDRVHSEADMIFSVLDNLILQMKGSGYVPD 214 W+EVNNE H FVARD H EAD+I+SVL LILQ+K GYVP+ Sbjct: 690 WIEVNNEAHVFVARDWTHYEADLIYSVLHYLILQIKEIGYVPN 732